SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MMI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MMI1
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily Globin-like 1.04e-47
Family Globins 0.000000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MMI1
Sequence length 142
Comment (tr|F1MMI1|F1MMI1_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000022037} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
ISLTRTERTIIVSLWSKISTQADVIGTKTLERLFSCYPQAKTYFPHFDLHTGSAQLRAHG
SRVVAAVGDAVKSIDNVTSALSKLSELHAYVLRVDPVNFKFLSHCLLVTLASHFPADFTA
DAHAAWDKFLSIVSGVLTEKYR
Download sequence
Identical sequences F1MMI1
ENSBTAP00000022037 9913.ENSBTAP00000022037 ENSBTAP00000022037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]