SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MMQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MMQ8
Domain Number 1 Region: 316-468
Classification Level Classification E-value
Superfamily Spectrin repeat 1.99e-32
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 2 Region: 422-578
Classification Level Classification E-value
Superfamily Spectrin repeat 4.8e-32
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 3 Region: 634-787
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-30
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 4 Region: 1235-1391
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-29
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 739-894
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-29
Family Spectrin repeat 0.00048
Further Details:      
 
Domain Number 6 Region: 119-258
Classification Level Classification E-value
Superfamily Spectrin repeat 3.48e-28
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 1714-1817
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-27
Family Spectrin repeat 0.0000164
Further Details:      
 
Domain Number 8 Region: 1766-1923
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-27
Family Spectrin repeat 0.0000933
Further Details:      
 
Domain Number 9 Region: 17-152
Classification Level Classification E-value
Superfamily Spectrin repeat 3.46e-25
Family Spectrin repeat 0.00000129
Further Details:      
 
Domain Number 10 Region: 2036-2147
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-22
Family Spectrin repeat 0.00067
Further Details:      
 
Domain Number 11 Region: 1600-1718
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-22
Family Spectrin repeat 0.0000354
Further Details:      
 
Domain Number 12 Region: 1447-1569
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-21
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 13 Region: 1873-2028
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-21
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 14 Region: 972-1056
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-19
Family SH3-domain 0.00016
Further Details:      
 
Domain Number 15 Region: 898-962,1040-1078
Classification Level Classification E-value
Superfamily Spectrin repeat 1.71e-18
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 16 Region: 2154-2261
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-18
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 17 Region: 2263-2381
Classification Level Classification E-value
Superfamily EF-hand 5.43e-16
Family Calmodulin-like 0.016
Further Details:      
 
Domain Number 18 Region: 1086-1180
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000301
Family Spectrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MMQ8
Sequence length 2416
Comment (tr|F1MMQ8|F1MMQ8_BOVIN) Spectrin alpha, erythrocytic 1 {ECO:0000313|Ensembl:ENSBTAP00000053194} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SPTA1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
HFPKETAMESDGPEVLETAEEIQARRQEVLSRYQRFKERVAERGQKLEDSYHYQVFIRDV
DDHEKWIMEKIKTASDKSYEDPTNIQGKYQKHENFETEVQAKSRVLPDLEKTRETRFPEG
HFAHEDTKGLLEELNRLWDLLLELTQEKGALLLRALKLQQYFQGCADILEWIGDKDALVT
SMELGKDWERTEVLHKKFEEFLADMEVRKERVNEVNQYANECAEEKHPELPSIESKQKEV
NAAWERLHGLALQRQKMLSSAADLQKFKRDVTEAIQWIEEKEAQVTSEDYGKDLVSSEAL
FHSHKTLERSLAVMNDKVKELCSKADKLKLSHPSDAAEIQQMKEDLVSNWERIRNLATSR
YEKLQASYGYQRFLSDYDELSGWMEEKTALINADELPIDVTGGEALLDRHQQHKHEIDSY
DDRFQSANETGQTLLDANHEASDEVLEKMSLLTYNWVALLELWEKRRQQYDQCLNLHLFY
RDSEQVDSWMSRQEAFLENEDLGNSLGSVEALLQKHDDFEEAFTAQEEKITTIDKTATKL
IDDKHYDSEEIAAIRDELLVRRDNLRKRAAIRRGLLEDSFLLQQLYQDSDDLKNWINKKK
KLADDEDYKETLNLKSQVQKQKVFEEELAANQIRLNNIQKTGQEMIDSNHYASDKVADRL
REVESLWIELQEATEQKGIQLHEANKQLQFENNAEDLMQWLEEVEWQARSQDYGKGLADV
QNLLRKHGLLESAVATRQDQVDTLTDLVTYFEEIIHPDAGNIRERQEYLVSRFEALKERL
AYRKNKLIDLFYLYQIQRDTEDEEAWIQETVPSVASTYLGKDLITSKNLLNRHHVIQANI
ASHEPRIQMITEKGNKMIEEGHFAAEDVASRVKSLNENMESLQARATRRQNDLEANVQFQ
QYLVDLHEAEAWIREKEPIVDNTNYGADEEAAGALLKKHEAFLVDLKAFGNSMQALRDQA
EACQEQQAAPVEVAAPEERVVALYDFEARCSREVTMKKDDVLTLLSSISKDWWKVETDDH
QGFVPAVYVRKLARDEFPMLPQRKREEPGNIIQRQEQIENQYHSLLHRADERRRRLLQRY
NEFLLAYEAGDMLDWIREKKAENTGVELDDVWELQKKFDEFQMDLKTNEPRLRDINKVAD
DLQFEELLTPEGAQIQQELNARWRSLQRLAEEQRQLLGSAHAVQMFHREADDTKEQIEKK
CQALNTADPGSDLFSVQALQRQHENFERDLIPLGEKVEVLRDTADRLSESHPDATDDLQS
QQLKLKEAWDDLQGLTKDRKENLQEALKFYQFLSQARDLQNWISGIGGMVSSQELAEDLT
GTEIMIERHQEHRADMEAQAPAFQAFEDFGTDLTISGHRASPEIEEKLQAVRLERDELES
AWEQRKKMLDQCLELQLFRGNCDQAESWMVARENDLRSDDKGSLDTLEALMKKRDDLDKA
ITDQDNRITELDLFAERLISEDHYAKEEIAARNQRILDRWRILKEQLTAERMKLGDYADL
KQFYHDFKDQEEWISEMLPIACDESYKDPTNIQRKYLKHKAFEDEVNSRAEQVEGVIILG
NTLVERRACDGNEESVKQDQVEELEKNWNYLLAVTIDKGQKLDEASRQQRFNTGIRDFDF
WLSEAETLLTMKDQARDLASAGNLLKKHQLLETEMLARQDALQDLNTLATDLISSGTFNT
DQIVEKRDNVNERFLNVKELAAEHHEKLKESYALFQFFQDLDDEEFWIAEKLVRVRSQDY
GRDLQGVQNLLKKHRRLEGELLAHEPAIQNVLDTAERLGDKAAVGREEIQDRLDQLVQHW
DQLKELTKARGIQLGESLEYLEFMENAEEEEAWISEKEALVAQGDSGDTLAAIQSLQKKL
EALENDFAVHEIRVQNVCAQGEDILSKGESQHKEKISNKIQALNEKIPALARSLAVWKSQ
LEDDYDFQEFNWKADVVEAWIAEKETSLKTNSNDADLTALSTLLAKQETLHASLQSFHQE
RLSEITDLKDKLVAAEHSQTKAIEERHAALLRRWEQLLEASEVHRQELLEKQRPLLETEV
LFMKFAQEASAFNNWCEKAEEDLSEPVRCVSLDAIRQLQKDHEAFLASLTKARGDFNDLR
ELDQQIKALNVPSSPYTWLTVEVLERVWKHLLDTIKEREQELEKEEARQIKNFEMCQEFE
QNASAFLNWILETRDYFLDGSLLKETGTLESQLEANKRKQKEIQAKKHQLTKIEDLGESL
EEALVLDLKYSTIGLAQQWDQLYQLGMRRQHSLEEQIQARDITGLSEETRQEFETTFRHF
DENLTGRLSHKDFRSCLRGLNYYLPMVEEGEPEPKFEKFLDAVDPERKGYISKDEYIDFL
TDKESENIRSSDELEDSFQALAEGKAYITKEDMKQALTPEQVSFCASRMQQYVDPRGRSQ
PAGYDYVGFINSYFGK
Download sequence
Identical sequences F1MMQ8
ENSBTAP00000053194 ENSBTAP00000053194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]