SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MMR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MMR8
Domain Number 1 Region: 15-154
Classification Level Classification E-value
Superfamily Nudix 2.57e-33
Family MutT-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MMR8
Sequence length 172
Comment (tr|F1MMR8|F1MMR8_BOVIN) Nudix hydrolase 5 {ECO:0000313|Ensembl:ENSBTAP00000025989} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=NUDT5 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MEQETAGSSRNTEQSIISEELIAEGKWVKLEKTTYRDPTGKTRTWETVKRTTRKGQSADG
VAIIPVLQRTLHYECIILVKQFRPPMGGYCLEFPAGLIDDNESPEAAALRELEEETGYKG
DVAECSPAVCMDPGLSNCTAHIVTVTINGDDAENVRPKPKPGDGGTSSHPGG
Download sequence
Identical sequences F1MMR8
ENSBTAP00000025989 9913.ENSBTAP00000025989 ENSBTAP00000025989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]