SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MMV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MMV1
Domain Number 1 Region: 578-656,782-841
Classification Level Classification E-value
Superfamily EF-hand 3.11e-20
Family Calmodulin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MMV1
Sequence length 858
Comment (tr|F1MMV1|F1MMV1_BOVIN) EF-hand domain family member B {ECO:0000313|Ensembl:ENSBTAP00000053164} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=EFHB OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MCSFLRVPSPKGLEPSKGPVQLTPQRKSPLSMEVGLAPEGKDDLEERRVFMGTTSPTELG
LRVGLRKDFPCSKTYEERMASPEIRSPSSKGLELRLKRQNISRTVMDGSNLGVHRVSASQ
ETKPPLSALPGRVGLEKERFLAGYCPGRVTQPPLGQGCESPQASGGRRCPVTGDPEGFGA
SVSKLPALGMECRGELGGESACVVMKPRAETEPPVEVDMGLTRLEEPAEMESPEPQMGLV
MEPPAWQLAQQPEEQREAENTEPGVEPPDRIRPIYSGKFFDRMPCWPSAGKVLPIGYRAA
TCLTERFPRLMTPPEAKKFFNFRYPPAGAERVFYGRANDPQIAPSLTHGIRSKISIPAKV
LINPQPITTFQQKMKDKKESVYFSNQRAPLGKSHDQTPGLPKGLDILNTTFGTAIVRETS
ARDMVNPPKPYKEVFEEAQAGHDLYVVSHNDYFVGEAKNRKYDPSSFHRFNLYGIPTPHF
NDGRNMAKTLHWLHELQMKRGAKIVSKRVDDFKEKFQHRLGRVLDPIAETMNVPPDYTFG
AFLRPEDYGVGDLIHRRLPGEYLRGKDRQRGLVAAVRHHLKKVNYQNFDTLLAAFRHYDK
KGDGVIDRAELQEACDQACLHLDEKLLDQLFEYCDVDKDGLINYLEFANFLTWKDKTPLK
EYEEKVLIKGRKADCANPAEANVEESEPALLLKPEDIVLKEPGSSEKTLRTLLRPSDKVS
NHYKTTSSEISAVVGAVPSTCYPTYGVPTIRSDIPAPLIRRVSDRTSYGEEGNAYSLLHP
TIFAQKGVFERDFFKTRSKQEISEILCNIGVKLSEDEFENVWNLASKKHHRGEVCVENIR
SVLDELQHADGAKCKAAT
Download sequence
Identical sequences F1MMV1
ENSBTAP00000053164 ENSBTAP00000053164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]