SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MMZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MMZ9
Domain Number 1 Region: 24-62
Classification Level Classification E-value
Superfamily SAP domain 0.0000000989
Family SAP domain 0.0024
Further Details:      
 
Domain Number 2 Region: 312-356
Classification Level Classification E-value
Superfamily EF-hand 0.0000172
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MMZ9
Sequence length 538
Comment (tr|F1MMZ9|F1MMZ9_BOVIN) Cell division cycle and apoptosis regulator protein 1 {ECO:0000313|Ensembl:ENSBTAP00000049908} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
QDEEEKDDGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKSQLIARLTKQLK
VEEQKEEQKELEKSEKEEEEEDDRKSEDDKEEEERKRQEELERQRRERRYILPDEPAIVV
HPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLL
SLPEKEDKKEKEKKSKKDERKDKKEERDDETDEPKPKRRKSGDDKDKKEDRDERKKEDKR
KDDSKDDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEENKRDDKRDINRYCKERPSKDKE
KEKTQMITINRDLLMAFVYFDQSHCGYLLEKDLEEIFYTLGLHLSRAQVKKLLNKVVLRE
SCFYRKLTDTSKDEENHEESEALQEDMLGNRLLLPTPVVKQESKDVEENVGLIVYNGAMV
DVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDKDEKTILNLEISNKNLSGELREVKKDLSQ
LQENLKISENMNLQFENQLNKTIRNLSTVMDEIHTVLKKDNGKNEDKDQKSKENGASV
Download sequence
Identical sequences F1MMZ9
ENSBTAP00000049908 ENSBTAP00000049908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]