SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MPS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MPS1
Domain Number 1 Region: 64-221
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.96e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000996
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MPS1
Sequence length 226
Comment (tr|F1MPS1|F1MPS1_BOVIN) Retinoschisin 1 {ECO:0000313|Ensembl:ENSBTAP00000041587} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=RS1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
LDRKVVNFNLIFPLLSFCSATLGLSSTEDEGEDPWYHKACKCDCQGGANALWSAGPTPLD
CIPECPYHKPLGFESGEVTPDQITCSNVEQYVGWYSSWTANKARLNSQGFGCAWLSKFQD
SSQWLQIDLKEVKVISGILTQGRCDIDEWMTKYSVQYRTDESLNWIYYKDQTGNNRVFYG
NSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCT
Download sequence
Identical sequences F1MPS1
ENSBTAP00000041587 ENSBTAP00000041587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]