SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MPX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MPX5
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.67e-40
Family Dual specificity phosphatase-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MPX5
Sequence length 205
Comment (tr|F1MPX5|F1MPX5_BOVIN) Dual specificity phosphatase 22 {ECO:0000313|Ensembl:ENSBTAP00000039071} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=DUSP22 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
LGEGLNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS
QNLTRHFKESIKFIHECRLQGEGCLVHCLAGVSRSVTLVVAYIMTVTDFGWEDALHTVRA
GRSCANPNLGFQRQLQEFEELQVHQFRQWLREEYGESPLRDAEEARSILGKYKEQGRAEP
PPGARRWAGLRAPPPLAYGSYTPET
Download sequence
Identical sequences F1MPX5
ENSBTAP00000039071 ENSBTAP00000039071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]