SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1MS09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MS09
Domain Number 1 Region: 18-135
Classification Level Classification E-value
Superfamily POZ domain 5.89e-28
Family BTB/POZ domain 0.0065
Further Details:      
 
Domain Number 2 Region: 288-380
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000817
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MS09
Sequence length 385
Comment (tr|F1MS09|F1MS09_BOVIN) BTB/POZ domain-containing protein 9 {ECO:0000313|Ensembl:ENSBTAP00000000688} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=BTBD9 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSNSHPLRPFTAVGEIDHVHILSEHIGALLIGEEYGDVTFVVEKKRFPAHRVILAARCQY
FRALLYGGMRESQPEAEIPLEDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKY
GFPELEDSTSEYLCTILNIQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLS
LSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNSNENHAEIMQAVRLPLMSLTELLNVVR
PSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDT
QNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDW
IRVIDHSQYLCRSWQKLYFPARVCR
Download sequence
Identical sequences F1MS09 L8HWW6
ENSBTAP00000000688 ENSBTAP00000000688 9913.ENSBTAP00000000688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]