SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MS54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MS54
Domain Number 1 Region: 481-654
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.36e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0031
Further Details:      
 
Domain Number 2 Region: 636-733
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-19
Family Ypt/Rab-GAP domain of gyp1p 0.026
Further Details:      
 
Domain Number 3 Region: 801-927
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000119
Family Calmodulin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MS54
Sequence length 1255
Comment (tr|F1MS54|F1MS54_BOVIN) TBC1 domain family member 9B {ECO:0000313|Ensembl:ENSBTAP00000029792} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TBC1D9B OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MWLGTEEVLVANALWVTERANPFFVLQRRRGHGKGGGLTGLLVGTLDVVLDSSARVAPYR
ILHQTQDSQVYWTVACGSSRKEITKHWEWLENNLLQTLSIFDNEEDITTFVKGKIHGIIA
EENKNVQPQGDEDPGKFKEAELKMRKQFGMPDGEKLVNYYSCSYWKGRVPRQGWLYLTVN
HLCFYSFLLGKEVSLVVQWVDVTRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKL
MEQLANLAVRQLLDSEGFLEERAPPRPPRPHRNISALKRDLDARAKNECYRATFRLPRDE
RLDGHTSCTLWTPFNKLHIPGQMFISSNYICFASKEEDACHLIIPLREVTIVEKADCSSV
LPSPLSISTKSKMTFLFANLKDREFLVERISDFLQKMPSKPSGGSRAESKASIVDAAPEP
SPAPQELSEQPGPTSPLGGLPGGRAQEAPTASQGLLRLFQRNTPVEDLGAKGAKEKMKEE
SWNIHFFEFGRGMCMYRTARTRELVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVE
KSMGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVT
SVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGIFEELTRDFLPQLSKKMQDL
GVISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAILDANMEQLLGCGDE
GEAMTVLGRYLDNVVNKQSVSPPIPHLHALLTSGDDPPEEVDIFDLLKVSYEKFSSLRAE
DIEQMRFKQRLKVIQSLEDTAKRSVVRAIPGDIGFSIEELEDLYMVFKAKHLASQYWGSS
RPAAVRRDPSLPYLEQYRIDAHQFRELFASLTPWACGAHTPVLAGRMFRLLDENKDSLIN
FKEFVTGMSGMYHGDLTEKLKVLYKLHLPPALSPEEAESALEATHYFTEDSSSEASPLAS
DLDLFLPWKVQEVLQQEEREEAGNDIQDKRREEKGTSPPDYRHYLRMWAKEKEVQKETIK
DLPKMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKRFSAWPGRKSR
DSAPDEDESPAPDPPQDPAWELQPPAAGDPQAKAGGDTHLGKTPQESQVVGEGGGGEGRG
SPSQPLSDDETKDDMSISSYSVVSAGSLQCEDLADDTVLVGGEARSPVATTHGGGTVDTD
WCISFEQILASILTESVLVNFFEKRVDIGLKIKDHRKVERQFSTSSDHEQSVVLG
Download sequence
Identical sequences F1MS54
ENSBTAP00000029792 ENSBTAP00000029792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]