SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MSG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MSG9
Domain Number 1 Region: 194-440
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.09e-81
Family Eukaryotic proteases 0.00019
Further Details:      
 
Domain Number 2 Region: 49-173
Classification Level Classification E-value
Superfamily SEA domain 4.71e-20
Family SEA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MSG9
Sequence length 441
Comment (tr|F1MSG9|F1MSG9_BOVIN) Transmembrane protease serine {ECO:0000256|PIRNR:PIRNR037941} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TMPRSS11F OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
HYHRPLECSQANYPQVEYQRRQQCWGPISLSLFTLAIIAIIGIAIGIVTHFVVEDDKSFY
YLASFKATNIKYRECYGIRTSKQFIERSHQIERMMSRIFQHSGEGRFIKSHVIKLSPDQN
GMNIHMVLVFRFPSTDSAEQVRKKIERILYQSLKREPMPLTIYKPSFTLTPIDNKKMRNF
LNSRCGIRMTPSYMPLPAFASTERIVQGSEAALEGEWPWQASLQLIGAGHQCGASLISNT
WLLTAAHCFRRNKDPNRWIVTFGITITPPAVKRSLRKIIIHENYRKETNENDIALAQLDT
RVEFSNVVQRVCLPDSSIKLPPKTGVFVTGFGSIVDDVWVIGPTQNKLRQARVETISTEV
CNRKDVYDGMITSGMLCAGFMEGKVDACKGDSGGPLVYDNHEIWYLVGIVSWGQSCALPK
KPGVYTRVSQYRNWIASKTGI
Download sequence
Identical sequences F1MSG9
ENSBTAP00000005785 ENSBTAP00000005785 9913.ENSBTAP00000005785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]