SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1MSM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MSM8
Domain Number 1 Region: 330-560
Classification Level Classification E-value
Superfamily L domain-like 7.82e-35
Family Ngr ectodomain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 69-272
Classification Level Classification E-value
Superfamily L domain-like 1.02e-33
Family Ngr ectodomain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MSM8
Sequence length 842
Comment (tr|F1MSM8|F1MSM8_BOVIN) SLIT and NTRK like family member 6 {ECO:0000313|Ensembl:ENSBTAP00000005757} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SLITRK6 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MKLWIHLLYSSLLACISSQSQSPMPSASARGSCDSLCNCEEKDGTMLINCEEKGIKKLSQ
ISVPPSRPFHLSLLNNGLTVLHTNDFSGLTNAISIHLGFNNIADIETGAFNGLGLLKQLH
INHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPN
IFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKWACNCDLLQLKLWLENMPP
QSVIGDVVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPSGSLHLAVTSSISDSHMSA
KTTSLLKPPTKAPGLIPYITKPSTQLPGLYCPIPCNCKVLSPSGLLIHCQERNIESLSDL
KPPPQNPRKLILAGNIIHTLLKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYL
NGNHLTKLSGGMFLGLHNLEYLYLEYNGVKEILPGTFNPMPKLKVLYLNNNLLQVLPPHI
FSGVPLTRINLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKN
TVTDEILCTSPEHLHKKELKALNSELLCPGLVNNPSLPTQTSYIIVNTPTTTTTADNIFK
SLTDAVPLSVLILGLLIVFITIVFCAAGIVVLVLHRRRRYKKKQADEQMRDTSPVHLQYS
MYGHKTTHHTTERPTASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQR
SLLERENHSPLTGSNMKYKTTDQSTEFLTFQDASSLYRNILEKERELQQLGITEYLRKNI
AQLQPDTEVHYPGAHEELKLMETLLYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQ
QT
Download sequence
Identical sequences F1MSM8
ENSBTAP00000005757 XP_005194244.1.59421 XP_005213943.1.76553 XP_019827182.1.53367 ENSBTAP00000005757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]