SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MSR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MSR5
Domain Number 1 Region: 41-286
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.37e-53
Family Protein kinases, catalytic subunit 0.00074
Further Details:      
 
Domain Number 2 Region: 443-611
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-37
Family Ypt/Rab-GAP domain of gyp1p 0.0017
Further Details:      
 
Domain Number 3 Region: 589-701
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0081
Further Details:      
 
Domain Number 4 Region: 749-884
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 5.5e-18
Family Multidomain sulfurtransferase (rhodanese) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MSR5
Sequence length 893
Comment (tr|F1MSR5|F1MSR5_BOVIN) TBC1 domain containing kinase {ECO:0000313|Ensembl:ENSBTAP00000005539} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TBCK OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MFPLKDAEMGAFTFFASALPHDVCGSNGLPLTPNSIKILGRFQILKTITHPRLCQYVDIS
RGKHERLVVVAEHCERSLEDLLREGKPVSYSKVLCIAFEVLQGLQYMNKHGIVHRALSPH
NILLDQKGHVKLAKFGLYHMTAYGDDVDFPIGYPSYLAPEVIAQGIFKTSDHVPSEKPLP
SGPKSDVWSLGIILFELCVGRKLFQSLDISERLKFLLTLDCVDDTIIVLAEEHGCLDIIK
ELPETVIDLLKKCLTFHPSKRPTPDELMQDNVFSEVLPLYPPFIKPASLFSSSLRCADLT
LPEDISQLYEDINSDYLAERSIEEVYYLWCLAGGDLEKELVNKEIIRSKPPICTLPNFLF
EDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEAFYPLLEDDQSNLPHSNSNNEL
SAAATLPLIIRERDTEYQLNRIILFDRLLKAYPYKKNQIWKEARVDIPPLMRGLTWAALL
GVEGAIHAKYDAIDKDTPIPTDRQIEVDIPRCHQYDELLSSPEGHAKFRRVLKAWVVSHP
DLVYWQGLDSLCAPFLYLNFNNEALAYACMSAFIPKYLYNFFLKDNSHVIQEYLTVFSQM
IAFHDPELSNHLNEIGFIPDLYAIPWFLTMFTHVFPLHKIFHLWDTLLLGNSSFPFCIGV
AILQQLRDRLLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPT
SDSSGVRSSTPYFPTECPDPPKTDLSRESIPLNDLKSEVSPRISAEDLIDLCELTVTGHF
KTPTKKTKSSKPKLLVVDIRNSEDFVRGHISGSINIPFSTAFTAEGELTQGPYTAMLQSF
KGKVIVIVGNVAKHTAEFAAHLVKMKYPRICILDGGINKIKPTGLLTVPSPQI
Download sequence
Identical sequences F1MSR5
ENSBTAP00000005539 ENSBTAP00000005539 XP_002688132.1.76553 XP_005207731.1.76553 XP_015319190.1.59421 XP_015319191.1.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]