SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MT22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MT22
Domain Number 1 Region: 182-484
Classification Level Classification E-value
Superfamily L domain-like 1.02e-58
Family Ngr ectodomain-like 0.003
Further Details:      
 
Domain Number 2 Region: 46-249
Classification Level Classification E-value
Superfamily L domain-like 3.74e-52
Family Ngr ectodomain-like 0.0064
Further Details:      
 
Domain Number 3 Region: 542-848
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.39e-32
Family Rhodopsin-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MT22
Sequence length 907
Comment (sp|F1MT22|LGR5_BOVIN) Leucine-rich repeat-containing G-protein coupled receptor 5 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LGR5; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MDTSSVGVLLSLPVLLQLAAGGGSPRPGTLLRGCPAHCQCEPDGRMLLRVDCSDLGLSEL
PSNLSVFTSYLDLSMNNISQLPPSPLHSLRFLEELRLAGNALTYIPKGAFAGLYSLKVLM
LQNNHLRQVPTEALQNLRSLQSLRLDANRISSVPPSCFSGLHSLRHLWLDDNALTEIPVQ
AFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLD
LNYNNLDEFPTAVRTLSNLKELGFHSNNIKSIPEKAFVGNPSLITIHFYDNPIQLVGRSA
FQHLPELRTLTLNGASQITEFPDLTGTASLESLTLTGAQISSLPQTVCDQLPNLQVLDLS
YNLLEDLPSFSVCQKLQKIDLRHNEIYEIQADTFQQLFSLRSLNLAWNKIAIIDPNAFST
LPSLRKLDLSSNRLSSIPVTGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCC
AFGVCENVYKISNPWSKGDNSTAEDLHKKDAGVFQVQDERDLEDFLLDFEEDLRALHPVR
CSPSPGPFKLCEYLFGSWLIRIGVWTIAVLALTCNALVTSTVFRAAVYISSIKLLIGLIA
AVNMLMGVSSAVLAGVDAFTFGSFAQHGAWWEQAVGCQVVGFLSIFASESSVFLLTLAAL
ERGWSVKCSAKFETQTPFPSLRATLALCALLAGTVAAVPLLGGSEYSASPLCLPLPFGEP
RATGYMVALVLLNSLCFLVMTVAYTRLYCHLEKGDLESMWDCSMVKHVALLLFTNCILHC
PVAFLSFSSLLNLTFISPEVIKFILLVIVPLPACLNPLLYILFNPHFKEDLGSLGKQTHF
WTRSKHTSLMSINSDDVEKQSCDSTQALVTFTSASIAYDLPSSSGSPPAYPMTESCHLSS
VAFVPCL
Download sequence
Identical sequences F1MT22
ENSBTAP00000017631 ENSBTAP00000017631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]