SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MTE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MTE8
Domain Number 1 Region: 1389-1558,1613-1678,1746-1845
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.33e-115
Family Mammalian PLC 0.00000572
Further Details:      
 
Domain Number 2 Region: 239-335,397-459,509-726,754-799
Classification Level Classification E-value
Superfamily Ras GEF 1.31e-38
Family Ras GEF 0.0055
Further Details:      
 
Domain Number 3 Region: 2131-2242
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-36
Family Ras-binding domain, RBD 0.00000152
Further Details:      
 
Domain Number 4 Region: 2005-2111
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-31
Family Ras-binding domain, RBD 0.00000182
Further Details:      
 
Domain Number 5 Region: 1871-1982
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.13e-21
Family PLC-like (P variant) 0.0043
Further Details:      
 
Domain Number 6 Region: 1205-1236,1314-1377
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000066
Family EF-hand modules in multidomain proteins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MTE8
Sequence length 2299
Comment (tr|F1MTE8|F1MTE8_BOVIN) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PLCE1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTSEEMAGSVLRPVSQRKVISAQSTVDESNDKVSGISVPKSHPVRQSGETSHTISQPTKL
TEESSGSNAPQIFSVAREKITSDENSNEKCWEKSMPDSVKNLNINCNSILKNHQHGPPQS
QFYETCNSITEEGLCLETGIPSSLEGKVFPGIQLEIDTSPMGMSPLGTQSAIIETSRAHP
ESNMAVFHLRYEVDRRMSDSFCPLSDNLILDDCGNCVLPAVGEEQEKNYMAYTCKLMELT
NNCDNKNRQLQCDHCDPLNDKYLCFEGSCPKADVVCSSDSFCREDFTDSPPAKTFLSHFE
DFPDNCEEVEEDLFKNKKERSAWLVRRFCKNDKEVKKSVFTGTRAIVRTLPSGHIGLEAL
SYIDQKKNGLLLPPGRVMERLSTMVVRQDGSQGLSEAQWYPIYSAVRRGEATEQTIRSLL
HFFAKLPASETAHERISVGPYLKQCVRDTVCEYRATLQRTSISQYITGSLLEATTSLGAR
SSLLNSFGGSTGRMMLKERQPGTSMANSSALPSSSAGISKELIDLKPLIQFPEEVASILM
EQEQNIYRRVLPVDYLFFLTRGLGTTERQRSLPCLKASISASILTSQKGEHNALEDLVMR
FNEVSSWVTWLILAAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMW
QFMDQSDLETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGA
SGLMKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQIIRSCSRS
LETEEEDSSSEGSSSRKNSLKDKARWQFIIGDLLDSENDIFEQPKEWDSHGSEEPQKAFD
HGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWIKPTTAS
PASAKAKLGVLSNTSEPGKFPLLGNAGLSGLVEGILDLFSAKAVYMGHPNIDIHTVCVQN
KLSNMSLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQ
HWLRKQYVSLYQEDGRYEGPTLAQAVELFGGRRWSTRNPSPGTSAKSAEKPNTLSISNTK
KKKKILMRGESGEVTDDEMATRKARTHKESRSRSGSDPQDVNEQEESEANAIMNPPNPLP
SRRAHSLTTTGPPTLAAGTASPIRPVSSPVLPASNRSPTSAWNSSSGWPGKIKGGMQGFQ
SFMVSDSSMSFVEFVELFKSFSVRSRKDLKDLFDIYAVPCDRAGSEAAPLYTNLTIDENI
SGLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGVESTSLGVFGV
GILQLNDFLVNCQGEHYTYDEILSIIQKFEPSVSMCHQGLMSFEGFARFLMDKDNFASKN
DESQENVKEMQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGD
DGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEIFKTV
FGEKLVAKFLFESDFSDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASMQA
QAYNGSNANSPPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYNEEIP
KRIKKADNSACNKGKVYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGTGLST
LNASGSSRGKERKSRKSIFGNNPGRMSPGETAPFNKTSGKSSCEGMRQAWEDSAFSVNPT
TSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPNPL
LFWLHGIQLVALNYQTDDLSLHLNAAMFEANGGCGYVLKPPVLWDKNCSMYQKFSPLERD
LDSMEPAIYSLTIVSGQNVCPSNSTGSPCIEVDVLGMALDSCHFRTKPIHRNTLNPMWNE
QFLFRVHFEDLVFLRFAVVENNSSVVTAQRIISLKALKRGYRHLQLRNLHNEVLEISSLF
INSRRMEENSSGNTVLASLMFNTEERKCLQTHRVTVHGVPGPEPFTVFSINGGTKAKQLL
QQILVMDQDTKPIATDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIVQILSSWFPEEG
YVGRIVLKTQQENLEEKSIAQDDKEMLLSSEEDSFFVQVHDVSPEQPRTVIKAPRVSTAQ
DVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTANRKSSTPKASQRVLLDQECVFQAQ
SKWKGAGKFILKLKEQVQASREDKKKGISFASELKKLTKTKQPRGPTSPSQVLASENVQN
KEEKPVGGLPSSDTIDYRQ
Download sequence
Identical sequences F1MTE8
ENSBTAP00000025249 ENSBTAP00000025249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]