SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MTN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MTN6
Domain Number 1 Region: 687-802
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.36e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1125-1303
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-29
Family BCR-homology GTPase activation domain (BH-domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 456-576
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-25
Family Pleckstrin-homology domain (PH domain) 0.0000134
Further Details:      
 
Domain Number 4 Region: 883-1040
Classification Level Classification E-value
Superfamily PH domain-like 1.95e-22
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 1439-1571
Classification Level Classification E-value
Superfamily PH domain-like 4.53e-19
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.51e-16
Family SAM (sterile alpha motif) domain 0.0000555
Further Details:      
 
Domain Number 7 Region: 584-686
Classification Level Classification E-value
Superfamily PH domain-like 7.8e-16
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 8 Region: 1017-1117
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000822
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MTN6
Sequence length 1711
Comment (tr|F1MTN6|F1MTN6_BOVIN) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSBTAP00000044378} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ARAP2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSSVSEVNVDIRDFLMSINLEQYLLNFREFGFNNVRDCAEINDSVLLKVGISPTGHRRRI
LKQLQIILSKMQDIPIYANIHKTKKNDETSKDHQAPSSAQNTSLEFSDSHGVQIPSRIQL
ETVTKNVGENEVCVENSQSLKSDDKLTLPTHNFPIPEDEPHSNSGSFQDSLLRNEITDIE
SLITEKTVGCTAEEEHTGRDDLISENVGKLPNADLEFLSSHDSSVSEANSGNGTNVLLES
SPPSPFFQFQGEMVVNDLYVPSSPVLTPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGI
SGSYFRERRNVATSTGKSVTQQNTNEENSSSILPYGETFLLQRLENSKKRSIKNEFWTQE
ETLKGETTTERNSFFVKSSIYDNRTENISENKVEDIWIPREDKSNLPIDSASESEYSTVE
ECFQSLRRKNSKPSKSRTQKAANLDPVNRHSYPLSSTSGNADSPVISSNVISPYACFYGS
STRKVKSGWLDKLCPQGKRMFQKRWVKFDGLSISYYNNDKEKYSKGIIPLSAISTVRVQG
DNKFEVVTTQRTFVFRVEKEEERNDWISLLLNALKLQALSSQSQAAIAPEKCGYLELRGY
KAKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSF
TAESEKEKQEWIEAVQQSIAETLSDYEVAEKIWYNESNRSCADCKAPDPDWASINLCVVI
CKKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHM
DCSVEKRKNFITQKYKEGRFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVM
CATGDPEHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIYSEGRLNQESSQSTFLCDFL
YQAPAGASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAVHKE
DFCLNTGPIFTFEIYLPSERAFLFGAETSQVQRKWTEAIAKHFVPFVAENLTEADYDLIG
QLYYKDCHALDQWRKGWFAMDKSNLRFCLPMQEGQEDRMHLRRLQELTISTVVQNGEKLD
VLLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLGRNDVPIIVNSCIAFV
TQYDKGLGYKNIYQKNGDPLHVSELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDID
DALLTKELYPYWISALVTETEESSVMKKKYRVVLRGMPTNHRSTFSISDFHRVQKCSEIN
HMSAHNLALVFSSCFFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKW
KDTQVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKDDIWATF
EVIENEELAERPLHYTENVLEQVLRWSSLAEPGSAYLVVKRFLTIDTIKHYNERKALENI
KEGVLKVKEEPSKILSGNKFQDRYCVLRDGYLLLYKDLKSSKPDKMFSLSSVKFYLGVKK
KMKPPTSWGLTAYSEKHHWHLCCESSQTQTEWMANIFIAQHENDIWPPAGKERKRSITKN
PKIGGLPLIPIQHDRNATQARRETESAKAELERLRLGAKRDQGGDGTLKEKASIVAQCLE
HKDEKLRNRTRKHRSFNCLEDTEAEVFPGRQKGHKGLKTLRKTEDRNGKDTLDCNNKLPP
KVIEELSVVLQRSRTLPKELQDEQVVQKEIK
Download sequence
Identical sequences F1MTN6
ENSBTAP00000044378 ENSBTAP00000044378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]