SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MU53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MU53
Domain Number 1 Region: 128-217
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-36
Family SCAN domain 0.0000259
Further Details:      
 
Domain Number 2 Region: 476-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000292
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 321-350
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000196
Family KRAB domain (Kruppel-associated box) 0.0034
Further Details:      
 
Domain Number 4 Region: 428-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000184
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MU53
Sequence length 532
Comment (tr|F1MU53|F1MU53_BOVIN) Zinc finger protein 446 {ECO:0000313|Ensembl:ENSBTAP00000049195} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF446 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
QRPEVSSISAVGESSGAGAKGERLPGRGGRPPKPAAPQMPHGGTGRPSVMRGLRERAPAL
RPLLCSRAEAHGKRSPTGGGRGLGADHHLAVPWKLHPTPSGSRKIPRTMPSPLGPPNLPS
LDPEAIPENPETARQRFRGFCYQEVAGPRVALARLQFLCHQWLQPEAHSKEQILDLLVLE
QFLGALPPEIQAWVRGQQPGSPEEAVVLVEDLQRDPGQLLGWITAHVLQQAVLPATQKTE
ELVGGVHPSGTVEPLRAASGEGPKDAQMEGNAQLSCSVKEEPDGYMQEIASSSPPPPAQS
HKEHVEQQEPTSAPFQPPRLQEWGLLEPSQKELYWDAMLEKYGTVVSLGEDPSPCPGPWA
HLASQRFPRAGLPHPLPESRAESQPEVLSTGSEGRRRLRPGLLHSPGDESEGRPGGPEAP
PPPPPPRSKPYTCTQCGGAFDWKSVFVIHRRAHAGGPCTEKPPAGPPQRALPGPRGYACE
ECGHSFSWKSQLVIHRKGHAGQRRHLCADCGHSFDWKSQLVIHRKSHRPEAP
Download sequence
Identical sequences F1MU53
ENSBTAP00000049195 ENSBTAP00000049195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]