SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MUD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MUD3
Domain Number 1 Region: 560-601,686-738,773-792,824-874
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000258
Family Nucleotide and nucleoside kinases 0.01
Further Details:      
 
Domain Number 2 Region: 1465-1591
Classification Level Classification E-value
Superfamily EF-hand 0.00000124
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MUD3
Sequence length 1824
Comment (tr|F1MUD3|F1MUD3_BOVIN) Sperm flagellar 2 {ECO:0000313|Ensembl:ENSBTAP00000009967} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SPEF2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSEILCQWLNQELKVSQTVSPKSFAKAFSSGYLIGEVLHKFALQDDFADFSESRISSAKL
NNFSRLEPTLHLLGVQFDQNVAHNIITEKPGAATKLLYQLYIALQRKKKGVQTGVEMPTV
QPLMSTKVQNMKSEAFRDSHPRHMSQIEFFLSMIRQVMKVELVSPPIMKIDTFHLHNLGT
PKLCFNIILFKQRLSRRRQNEIMAKIQAAIIQIPKPTSNRTLKTLDAQKLMKKKKEAEDV
ANEIKKFEALIKKDLQAKESASKTSLDTAGQTTTDLLNTYSDDDYIKKIQKRLEEDAFAR
EQREKRRRRLLMDQLIAHEAQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQ
NRIFREKQYEERRLKDFQDALDREAALARQAKIDFEEQALRDKEIHEQIAIERAQARYEK
HYSICAEILDQILDLSTKVADYRLLTNNLIPYKLMHDWKELFFHGKPIYEQASLRHLPTK
LSAEHLIELEKRNLLDNNDYEEYKNMVGEWALPEEMVENLPPSNNCILGHVIHRLIESSL
PPQVESTVPELPSFAIKGCLLGKTFSGKTTALKALEKSFPIQVLSIDTLVQEAIQAFHDK
ESVSGAHGLQKAPEEKALPVRQESDEDNQACTSSPKDVQDGSLAEALPKKEDKTRLDTDA
RKAAKAEEVVASDSFSELTVRAQLGAKSERLLKKGKSISDILLVSIMVNAINQIPMYKGW
ILDGFPMTLNQAKLLEEALTGYNRNLIELEGKKSHTSTLAVDPTASKEVPLPPSAFDFVM
LLDISDNSSLNRMNDIMAEAFSSETPLEDINQRVAAKNKDTDEDQNLRDQIQHRIVGFLD
NWPSLEQWFTEPENILIKINAEVDKQSLCQKVKEMFMTEIMKKENKVKKKLEEKEAERKE
EVSLTEKTSPPPPPPPPPEPEKEKEVHLPQERSKTPAAKGKQASEPPHGNREPLQEGKGK
KSETSLKRKGSPRGKSLGGKIPLKKSPAESTDVSPVPVVPAPSKPGSEEWVYVNEPIPEE
IPSFLVPYWKLIENSYINSIKTVLRQLREDQHAVLAYLYDIRTGFQQFLRRPDHKQDFVS
QWQADFNSLPDDLWDDEETKAELHQRVNDFRDRLWDICDARKEEAEQERLDIINESWLQD
STGIAMNHFFSLMQAELNRFQDTKRLLQDYYRAMECKIPMDDTKRFTRVPLVQLDSKDIL
ESQLRIPLVPRRSISPESALSKPKTKSILKGKIDYMLESVELNFEADEKMVMDTWQQSSL
AISHMVAAEIHQRLMEEEKENQPAETKEKLPQAAANKKVKKEPPPPPPPPKKKKEDKKGK
GKSPPMTEAAPVVLPAEETEEVEVKNELKLRIKEEHLAALQFEEIATQFRLELIKVKALA
FLEELVIKAVDVYRLMEKWLGERYLNEMASVEKLTGVARYHIETSTKIQNELYLDQEDFF
INGDIKVFPDPPPPVRPPPVEKEENGTLTIEQLDNLRDQFLDIAPKGIIGNKAFADLLLD
LVTLNLGTNNFPSSWMNLTQPELQELASLLVTNSESVDWRKFLLVVALPWPIPLEEELLE
TLQRFKALDAEQLGTITYEQYKQAGLWFTGDEDIKIPENPLEPLPFNRQEHLIEFFFRLF
ADCEKDPPQLDYTQMLLYFACHPDSTEGVYRALSVAIGTHVFQPIEMPHPVAEKTSSFTD
MSPIEEYPELEDNFMSEERELQEDGEEKEEEIPENANTEMISMQTLLQVFRGGNEVLDAN
RFASHQKLENTYLENFIKVFQDLGSKNLEPIEVAVLLKHPFIQDLISSYPDYKIPDVKII
LQRSEHVQGSDEERSPSRLTEEKK
Download sequence
Identical sequences F1MUD3
ENSBTAP00000009967 ENSBTAP00000009967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]