SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MUY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MUY0
Domain Number 1 Region: 1-48
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 2 Region: 61-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000388
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MUY0
Sequence length 102
Comment (tr|F1MUY0|F1MUY0_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000016860} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
HQRIHTGEKPYPCNEYGKSFRKIPRLINHQKTHSGDKSYQYNDHGKAFMRSSALIEHRRI
HTEEKPYHCRNIRNPSGLVEYLKIHPGEKPYECNECGKAFPQ
Download sequence
Identical sequences F1MUY0
9913.ENSBTAP00000016860 ENSBTAP00000016860 ENSBTAP00000016860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]