SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MW70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MW70
Domain Number 1 Region: 24-168
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-31
Family Dual specificity phosphatase-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MW70
Sequence length 345
Comment (tr|F1MW70|F1MW70_BOVIN) Dual specificity phosphatase 12 {ECO:0000313|Ensembl:ENSBTAP00000028997} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=DUSP12 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MLEAQEGSHGWEHQIGSQSRASSARHMLEVRPGLFLGGAAAVAEPDHLREAAVTAVLTVD
SEEPNFKTGAGVEGLRSLFVPALDKPETDLLSHLDRCVAFIVQARAEGRAVLVHCHSGVS
RSVTVITAFMMKTDQLTFEEAYENLKTVKPEAKMNEGFEWQLKLYQAMGCEVDTSSAVYK
QYRLQKVTEKYPELQNLPQELFAVDPSAISQGLKDGGLYKCRKCRRSLFRSSSVLDHNEG
SGPIAFAHKRMTASPMLSAGSQAQCTSYFIEPVQWMESTLLGVMDGQLLCPKCNAKLGSF
NWYGEQCSCGRWIAPAFQIHKSRVDETKTLPMWGSQTRETGTRYM
Download sequence
Identical sequences F1MW70
ENSBTAP00000028997 XP_002685893.1.76553 XP_581568.3.59421 9913.ENSBTAP00000028997 ENSBTAP00000028997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]