SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1MWL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MWL1
Domain Number 1 Region: 15-271
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.1e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MWL1
Sequence length 755
Comment (tr|F1MWL1|F1MWL1_BOVIN) Tyrosine-protein phosphatase {ECO:0000256|RuleBase:RU364084} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PTPN12 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
FSFDFKRLRRLSTKYRTEKIYPTATGEKEENVKKNRYKDILPFDHSRVKLTLKTPSQDSD
YINANFIKGVYGPKAYVATQGPLANTVIDFWRMIWEYNVVIIVMACREFEMGRKKCERYW
PLFGEDPITFAPFKISCEAEQARTDYFIRTLLLEFQNESRRLYQFHYVNWPDHDVPSSFD
SILDMISLMRKYQEHEDVPICIHCSAGCGRTGAICAIDYTWNLLKAGKIPEEFNVFNLIQ
EMRTQRHSAVQTKEQYELVHRAIAQLFEKQLQLYEIHGTQKITDGVNEVNTENMISSTDH
DKQDSPPPKPPRTRSCLVEGDAKEEILQPPEPHPVPPILTPSPPSAFPTVTTVWQDNDRY
HPKPVLHMVSSEQPSTDLNRNYSKSMELTGKNESTIDQIDKKLERNLSFEIKKVPLQEGP
RSFDGNTLLNRGHAIKIKSASASPCTVDKISKSQELSSRDLKVDDISQNSCVDCNATQSN
KDPIILPEASQKNSDTPPRPDHLPLDGKGHLTWSFHGPENTLPMPDSSEGKSSDIHCQTM
KTVSSTPSPTIQVETHDLADHHDSSPLFRAPLSFTNPLHSDDSDSDERNSDGSVTKNKTS
ISTASATVSAATSSISTRKVLPMSIARHDIAGTIHSGAEKDVDVSEDSPPPLPERTPESF
VLANEHNTSVRAEWSELQNQEQSEQKNPEGLITSGSETCDHPAQGIHTETCTECPPTVSN
KKDQLSEGPTEATEIGFGNRCGKPKGPRDPPSEWT
Download sequence
Identical sequences F1MWL1
ENSBTAP00000004985 9913.ENSBTAP00000004985 ENSBTAP00000004985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]