SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MWM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MWM8
Domain Number 1 Region: 350-490
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-41
Family C-type lectin domain 0.00033
Further Details:      
 
Domain Number 2 Region: 638-781
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-39
Family C-type lectin domain 0.000000284
Further Details:      
 
Domain Number 3 Region: 932-1082
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-38
Family C-type lectin domain 0.0004
Further Details:      
 
Domain Number 4 Region: 792-925
Classification Level Classification E-value
Superfamily C-type lectin-like 4.55e-38
Family C-type lectin domain 0.00032
Further Details:      
 
Domain Number 5 Region: 21-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.07e-35
Family Cysteine rich domain 0.00000119
Further Details:      
 
Domain Number 6 Region: 1220-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-35
Family C-type lectin domain 0.00022
Further Details:      
 
Domain Number 7 Region: 500-638
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-32
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 8 Region: 223-346
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-31
Family C-type lectin domain 0.00074
Further Details:      
 
Domain Number 9 Region: 1089-1217
Classification Level Classification E-value
Superfamily C-type lectin-like 8.25e-30
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 1.6e-19
Family Fibronectin type II module 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MWM8
Sequence length 1455
Comment (tr|F1MWM8|F1MWM8_BOVIN) Mannose receptor C-type 1 {ECO:0000313|Ensembl:ENSBTAP00000051181} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=MRC1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
TKKYLILYFIVFISKFVFLRDTRPFLIYNEDHKRCVEALSPSAVQTAVCDPNNEAQKFRW
VSESQIMSVALKLCLGVPSKTDWVPVTLYACDSRSEFQKWECKNDTLLGIKGEDLFFNYG
NRQEKNIMLYKGSGLWSRWKIYGTTDDLCSRGYEAMYTLLGNANGATCAFPFKFENKWYG
ECTKAGRSDGWLWCGTTTDYDTDRLFGYCPLKFEGSESLWTKDPLTSIYYQINSKAALTW
HQARKSCQQQDAELLSITEIHEQTYLTGLTNSLTSGLWIGLNSLNFNSGWQWSGGSPFRY
LNWLPGSPSAEPGKSCVSLNPGKNAKWENLQCVQKLGYICKKGNTTLNPFVIPSESDVPT
NCPSQWWPYAGHCYKIYREEKKIQRDALRACRKEGGDLASIHSIEEFDFIISQLGYEPSD
ELWIGLNDIKIQMYFEWSDGTPVTFTKWLHGEPSHENNRQEDCAVMKGKDGYWADRACER
PLGYICKMKSQAQTPGVVEVEAGCQKGWKRHGFYCYLIGHTLSTFTEANQTCVSEKAYLT
TVEDRYEQAFLTSLVGLRPERYFWIGLSDVQHKGTFQWTVEEGVQFTHWNSDMPGRKAGC
VAMKTGVAGGLWDVLRCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPEDWGASSKTSLCF
KLFAKGKHEKKTWFESRDFCRALGGDLASINSKEEQQAIWRLVTASGSYHELFWLGLTYG
SPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIR
KGQTPKPEPTPAPHDNLPVTDDGWVIYKDYQYYFSKEKATMDKAREFCKRNFGDLVSIRS
ESEKKFLWKYVNRNDVQPAYFIGLLISLDKKFIWMDGSKVDYVAWATGEPNFANDDENCV
TMYSNSGFWNDINCGYPNAFICQRHNSSINATVVPTTVSVPGGCKEGWNFYNHKCFKIFG
FVEEERKNWQEARKDCIGFGGNLASIYSEKEQAFLTYHMKNSTFNAWTGLNDINSEHTFL
WTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNTRDAGKWMDDTCDSKRGYICQT
HPDRSLPSSPTTIPTDGFIKYGESSYSLMKLKLQWHEADDYCKMHTSHIASILDPYSNAF
AWMHMQTLNEPVWIALNSNLTNNDYIWTDKWRVRYTNWAPDEPRLKSACAYMDLDGYWKT
AQCNESFYFLCKRSDEIPATEPPQLPGRCPETEHSAWIPFHGHCYYIESSFTRNWGQASL
ECLRMGSSLVTIESAAELSFLSYRVEPLQSKTNFWIGLYRNVEGMWVWINNNPLSFVNWK
TGDPSGERNDCVTLYASSGLWSNIHCSSYKGYICKRPKIVDAEPTHTLITTKADPRKMEP
SKPSSSATGVVVIVVLLIIMGAGFAVYFFYKKRRVHLPREDAFENTLYFNSGSSPGTNDT
KDLMGNIEQNEHAAI
Download sequence
Identical sequences F1MWM8
ENSBTAP00000051181 ENSBTAP00000051181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]