SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MWN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MWN2
Domain Number 1 Region: 247-516
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.77e-80
Family Protein kinases, catalytic subunit 0.000000000178
Further Details:      
 
Domain Number 2 Region: 137-279
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-38
Family SH2 domain 0.00000275
Further Details:      
 
Domain Number 3 Region: 79-161
Classification Level Classification E-value
Superfamily SH3-domain 2.14e-22
Family SH3-domain 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MWN2
Sequence length 524
Comment (tr|F1MWN2|F1MWN2_BOVIN) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=HCK OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
LGGRSSCEDPGCPPEEERAPRMGCVKSKFLRNGGKVSKTEPNTNPHSPLYVPDPTSSGKR
WPDSSNGNPPGSTEGSEDIIVVALYDYDAIHHEDLSFQKGDQMVVLEESGEWWRARSLAT
RKEGYIPSNYVARVNSLETEEWFFKGISRKDAERQLLAPGNVLGSFMIRDSETTKGSYSL
SVRDYDPQHRDTVKHYKIRTLDNGGFYISPRSTFGSLQELVAHYKKASDGLCQKLTVPCM
SSKPQKPWEKDAWEIPRESLKMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAF
LAEANLMKTLQHDKLVKLHAVVTEEPIYIITEFMAKGSLLDFLKSEEGSRQPLPKLIDFS
AQIAEGMAFIERRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIK
WTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPDNC
PEELYNIMTRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
Download sequence
Identical sequences F1MWN2
ENSBTAP00000037156 ENSBTAP00000051020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]