SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MX88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MX88
Domain Number 1 Region: 332-607
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.96e-79
Family Mitochondrial carrier 0.000051
Further Details:      
 
Domain Number 2 Region: 22-160
Classification Level Classification E-value
Superfamily EF-hand 6.76e-19
Family Calmodulin-like 0.033
Further Details:      
 
Domain Number 3 Region: 162-281
Classification Level Classification E-value
Superfamily EF-hand 0.0000000121
Family Calmodulin-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MX88
Sequence length 679
Comment (tr|F1MX88|F1MX88_BOVIN) Solute carrier family 25 member 13 {ECO:0000313|Ensembl:ENSBTAP00000004912} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SLC25A13 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MKTGSAELEKFTRERQNKIYFLLFKQYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKT
VELLSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFG
QTTIHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDSARTGK
VTAIDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIY
STLAGNRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLE
EGTLPFNLAEAQRQKKASVDSSRPILLQIAESAYRFGLGSIAGAVGATAVYPIDLVKTRM
QNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVR
DKFMRRDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRD
LGFFGIYKGAKACFLRDIPFSAIYFPCYAHVKAALANEDGQISPGSLLLAGAIAGMPAAS
LVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVT
LLTYELLQRWFYIDFGGVKPMGSEPVPKSRITLPAPNPDHVGGYKLAVATFAGIENKFGL
YLPLFKPSASTSQAMGGGP
Download sequence
Identical sequences F1MX88
ENSBTAP00000004912 ENSBTAP00000004912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]