SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MXE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MXE6
Domain Number 1 Region: 21-156
Classification Level Classification E-value
Superfamily SNARE-like 2.11e-29
Family Clathrin coat assembly domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MXE6
Sequence length 185
Comment (tr|F1MXE6|F1MXE6_BOVIN) Coatomer protein complex subunit zeta 2 {ECO:0000313|Ensembl:ENSBTAP00000051299} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=COPZ2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
LGSAGPPRRRADLQEPSLYTIKAVFILDNDGHRLLAKYYDDTFPSMKEQMAFEKNVFNKT
SRTDSEIAFFGGMTIVYKSSIDLFLYVVGSSYENELMLMSVLTCLFESLNHVLRKNVEKR
WLLENMDGAFLVVDEIVDGGVILESDPQQVIQKVNFRADDSGLTEHSVAQVLQSAKEQIK
WSLLK
Download sequence
Identical sequences F1MXE6
ENSBTAP00000051299 ENSBTAP00000051299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]