SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1MYA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MYA3
Domain Number 1 Region: 156-319
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.93e-43
Family Dual specificity phosphatase-like 0.0000136
Further Details:      
 
Domain Number 2 Region: 332-466
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.39e-30
Family PLC-like (P variant) 0.0023
Further Details:      
 
Weak hits

Sequence:  F1MYA3
Domain Number - Region: 14-146
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0212
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MYA3
Sequence length 467
Comment (tr|F1MYA3|F1MYA3_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000035646} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
SKIKRIVYLIISSFTFRIFAILLIFLDMALIIKDVIFLSGTTQISLESRSVSFVIAFFFF
MDVSLRVFIEGIRPYFSDIFNSLDAAIIIVTLLVDITYLLYDSILAKIFPRLRIVLRPVR
LVILIRVFHLAYQKRHLEMLTRRMVSGNKRRYKKDGFDLDLTYVTERIIAMSFPSSGKQS
FYRNPIKEVVRFLDTKHPNHYQVYNLCSERAYDPKYFHHRVHRYLIDDHNVPSLSEMLAF
SMEVKEWMAQDKDNIIVVHCKGGKGRTGTMVCAYLLASEIFATAEDSLYYFGERRTDKST
SSKFQGIETPSQNRFVGYFAMVKNIYNLTLPPIKKLTIKKFVIYSIHGVGKGNGHDLKVQ
IIMQRKTVFFCSASKNCRIFHDAETDRVIILLSKCPPLYDEVKVRFFSSSALPKYYENCA
FFFWFHMSFIRNNRLYLSRSELDNPHKIKAWKAYSPQFAVEVYFDDI
Download sequence
Identical sequences F1MYA3
9913.ENSBTAP00000035646 ENSBTAP00000035646 ENSBTAP00000035646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]