SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MYV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MYV6
Domain Number 1 Region: 77-372
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.35e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000822
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MYV6
Sequence length 375
Comment (tr|F1MYV6|F1MYV6_BOVIN) Protein tyrosine phosphatase, non-receptor type 20 {ECO:0000313|Ensembl:ENSBTAP00000019887} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PTPN20 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
VFQNEVNSRKLKVFLRDFQHSDDFEDQFKDEAESENDGTLRKTSSFFLKQKSSSEDEELA
GPSHPALQAVSPRMEIVSEKELAQLALVRPLIFNTQEESTIRDYFKILTKKVSEDEITQE
FKALEVKNLPAVFHSGNELHNRDKNRYRDILPYDSTRVPLGNKDYINASYIKIANSREEY
YYIATQGPLPTTTNDFWQMVCENNSVIVMITKEKEGGVKCHHYWPISMKKPLELNSCRIF
LENYQILRYFIIRMFQVVKKSTGASHFVKHLQFTNWPDHGTPASAEGFIKYVRYVRKSHL
TGPVVVHCSAGVGRTGVFLCVDVVFCAIEKNFSFDIMNIVSQMREQRHGMVQTKEQYMFC
YKIVLEVLQKLWTVK
Download sequence
Identical sequences F1MYV6
ENSBTAP00000019887 ENSBTAP00000019887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]