SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1MZ10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MZ10
Domain Number 1 Region: 5-301
Classification Level Classification E-value
Superfamily L domain-like 6.8e-61
Family Leucine rich effector protein YopM 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MZ10
Sequence length 432
Comment (tr|F1MZ10|F1MZ10_BOVIN) Leucine rich repeat containing 1 {ECO:0000313|Ensembl:ENSBTAP00000023310} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LRRC1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
DIPEIPESISFCKALQIADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYN
LASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSEL
PQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNLLEMLPDGIGKLKKLSILK
VDQNRLTQLPEAVGDCESLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIG
GCCSLTVFCVRDNRLTRIPAEVSRAAELHVLDVAGNRLSHLPLSLTALNLKALWLSDNQA
QPLLTFQTDTDHTTGEKILTCVLLPQLPSEPACQENLPRCGALESLVHDVSEEAWNERAV
NRVSAIRFLDDEKDDDDNETRTLLRRATPHPGELKSMKKTVENLRNDRNAAKGLDSNKNE
VNHAVDRVTTSV
Download sequence
Identical sequences F1MZ10
ENSBTAP00000023310 ENSBTAP00000023310 9913.ENSBTAP00000023310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]