SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MZ78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MZ78
Domain Number 1 Region: 47-203
Classification Level Classification E-value
Superfamily L domain-like 5.44e-30
Family Internalin LRR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MZ78
Sequence length 1030
Comment (tr|F1MZ78|F1MZ78_BOVIN) Leucine-rich repeat and coiled-coil domain-containing protein 1 {ECO:0000313|Ensembl:ENSBTAP00000004335} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LRRCC1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
SGAMEAPGEAEVENEDGDSNCGDLCFMDKGLRSISELSLDSALHAINLHCNNISKITSID
HVWNLQHLDLSSNQISQIEGLNTLTKLCTLNLSCNLITRIEGLEALSNLTRLNLSYNHIN
DLSGLMPLHGIKHKLRYIDLHSNCIDSIHHLLQCTVGLHFLTNLILEKNGEDNPVCHLPG
YRAVMLQTLPQLRILDCKNIFGEPINMAEINSSHLQCFEGLLDNLVSSESPLNISEDEIT
DGMPVAPPVGDTVPLDQFPSTPTDTGLTSLMSVCPSSEPEKVNHENDLQNEMKLQKLDDQ
ILQLLSETSNSIIDNVPEKDPRPKRDTDVTSESDYGNRKECSKKTSRRSKIPYYSKTIQT
IKHHSKNSSTFISCNRKMKPPFLKELYISSSLPNNSTLEESENQKTEIMKVNNDCPEDAT
YRALVEELDEEREKRWKAEQTEKKLMDYIDELHKHADEKKDIRSQALLTTDRLKEIIFKE
RNSKLQLEIMVHRLQNEIKKLTIELIKARDQQDDHIRHLRTLEKALEKMERQKGQQQAAQ
MRLIQEVELKAAAADREINLLRTSLHQEKEQGAQLHELLALKEKEHRKDIETREFFSEAE
FQEALAKEIAKEERKHEQVIKEYQDKIDALNQQYMDLENEFRIALTVEARRFKDVKDGFE
NVATELAKSKHALVWAQRKENESSSLIKDLTCMVKEQKTKLAEVSKLKQETAANLQNQIN
TLEILIEDDKQKSIQIELLKQEKMQLISELAAKESLIYGLRTERKVWGHELALQGSSLVQ
NHGRVEAQLESLYRENECLRKASERDSDTIRIKCKIIDDQTETIGKLKECLQEREEQIKI
LHEKITEIQKCTQEQLEEKSSQLDEIVEKLERHNERKEKLKQQLKVKELELDEIRKAYST
LNQKWHDKGELLCHLEMQVKEVKENFENKERKLKAERDKSIELQKDAMEKLQSMDDAFKK
QVDAIVEAHQNEIIQLANEKQKCIDSANLKVHRVEEEMRGLLEETCKNKKAMETKIKQLA
FALSQIQQEI
Download sequence
Identical sequences F1MZ78
ENSBTAP00000004335 ENSBTAP00000004335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]