SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N008 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N008
Domain Number 1 Region: 921-1199
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.85e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000136
Further Details:      
 
Domain Number 2 Region: 348-531
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000369
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 3 Region: 533-715
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000584
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 4 Region: 725-814
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000279
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1N008
Sequence length 1221
Comment (tr|F1N008|F1N008_BOVIN) Protein tyrosine phosphatase, receptor type O {ECO:0000313|Ensembl:ENSBTAP00000030443} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PTPRO OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
WGKLSQYNFNENNLKLDLHFLFLCFLKQDATTFHVTVRDDNSIAVSLEASDIMSPSSVYV
VKITGESKNYFFEFEEFNSTLPPPIIFKANYHGLYYIITLVVVNGNVVTKPSRSITVLTK
PLPVTSVSIYDYKPSPETGVLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTV
FNHWLPGICYSNITFQLVSEANFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNK
NNWEEESGSFPEESFMRSQDTTGKGKVFHFTDDTPEIPSGNISSGWPDFNSSDFETTSQP
YLWDSASATPESEDEFVSVLPTEYENNSTLSDMEKSASSSFSSFPVQMILSWLPPKPPTA
FDGFHIHIEREENFTEYLTVDEEAHEFVADLKEPGKYKLSVTTFSSSGSCETRNSQSAKS
LSFYISPSGEWIEELTEKPQHVSVHVLSSTTALMSWTSPQENYNGTIVSVVSLTCQKQKE
SQRLEKQYCTQVNSSKSIIENLVPGAQYQVVMYLRKGPLIGPPSDPVTFAIVPTGIKDLM
LYPLGPTAVVLSWTRPYLGVFRKYVVEMFYFNPTTMTSEWTTYYEIAATVSLTASVRIAN
LLPAWYYNFRVTMVTWGDPELSCCDSSTISFITAPVAPEITSVEYFNSLLYISWTYGDDT
TDLSHSRMLHWMVVAEGKKKIKKSVTRNVMTAVLSLPPGDIYNLSVTACTERGSNTSMLR
LVKLEPAPPKSLFAVNKTQTSVTLLWVEEGVADFFEVFCQQVGSSQEAKLQEPISVSSHV
VTISSLLPATAYNCSVTSFSHDSPSVPTFIAISTMVTEMNPNVVVISVLAILSTLLIGLL
LVTLIILRRKHLQMARECGAGTFINFASLERDGKLPYNWRRSIFAFLTLLPSCLWTDYLL
AFYINPWSKNGLKKRKLTKQSPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHF
AADLPLNRCKNRYTNILPYDFSRVRLISMNEEEGADYINANYIPGYNSPQEYIATQGPLP
ETRNDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMMSEEEQDD
WACRHFRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHKVRQQAMKSKGPMIVH
CSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLM
WMKKKQQFCISDVIYENVSNS
Download sequence
Identical sequences F1N008
ENSBTAP00000030443 ENSBTAP00000030443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]