SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N062 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N062
Domain Number 1 Region: 42-199
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.17e-34
Family Dual specificity phosphatase-like 0.0000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1N062
Sequence length 1075
Comment (tr|F1N062|F1N062_BOVIN) Dual specificity phosphatase 27, atypical {ECO:0000313|Ensembl:ENSBTAP00000011408} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=DUSP27 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MLESAEQLLVEDLYNRVREKMDDTSLYNTPCILDLQRALVQDRQEAPWNEVDEVWPNVFI
AEKSVAVNKGRLKRLGITHILNAAHGTGVYTGPEFYTGLEIQYLGVEVDDFPEVDISQHF
RKAAEFLDEALLTYRGKVLVSSEMGVSRSAVLVVAYLMIFHNMAVLEALMTVRKKRAIYP
NDGFLKQLRELNEKLMEEREEDFSRECGEEAVEEGEDAGSTVAARVHTLTVEEEDDAASH
LSTSSLGRASQASKPLTLIDEEEEERLYEAWKKGQSLPTGKVLQGEDDRFSASSRQGEEP
EDEDVERIIREWQSRNERYQAEGHRRWNREEEEEEESNGSSFVRRRRRHTLSESSTSESV
SSHDIRVLKQQLQMSSQNRGGRRRSDSMSTESTWDMWDQRLQEIEKEASRKYHSRNKREE
VDASSEVGSRAREDDEESVASEASSFYNFCSRNKDKLTALERWKIKRIQFGFHKKDSEAG
DGSSEQGAEEVEGEKKNLSDVNLSAYQAWKLKHQKKVGSENKEEVVELSKGDDLALVKKR
QRRLELLERSRQTLEESQSMGSWEADSSAASGSIPLSAFWSAAPSVSADGDTASVLSAQS
HSSHPSQALSKVGGCLASTPTTPLPNLHVGPGDTISIASIQNWIANVVSETLAQKQNEML
LSPRPLSVVSMKAAPAGSCLGDDQVSMLSGQSSSALGGCLLPQSQARPSSETQSVLSSHT
MSARAEGTGSKVKGTSKPIYSLFADNIDLKELGRKEKEMQTELREKMSEYKMEKLASDNK
RSSLFKKKKVKEDEDEDDDVGDRDEDTDSAIGSFRYSSRSNSQKPETDTFSSLAVSDGYG
SGSRAGREKDNSINKWLSGLRTEEKSPQSDWSGSSREKCTRSSLIRETESKSSSYKFSKS
RSEEQDTSSYDETNSNSVKSTSRFSASSTREGREMHTFSRSMFSETSSSREESPEPYFFR
RTPEPSEGEESPEPRRPNGTRSRDWEDVEESSKSDFSEFGAKRKFTQSFMRSEEEGEKAR
MEKKEEGRFASGRQSRYWRSTDREEEEEMDDEAIIAAWRRRQEETRTKLQRRRED
Download sequence
Identical sequences F1N062
ENSBTAP00000011408 9913.ENSBTAP00000011408 ENSBTAP00000011408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]