SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N090 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N090
Domain Number 1 Region: 303-494
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.37e-52
Family Ypt/Rab-GAP domain of gyp1p 0.0018
Further Details:      
 
Domain Number 2 Region: 476-594
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.33e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1N090
Sequence length 675
Comment (tr|F1N090|F1N090_BOVIN) TBC1 domain family member 15 {ECO:0000313|Ensembl:ENSBTAP00000030401} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TBC1D15 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
CIPVGHCTGTMIIYEQEGVYIHSSLGKTNDQDSLISGILRVLEKDAEVIVDWRPLDDALD
SSSILYAGKDSSSVVEWTQAPKERAHRVAEHLNSYEAEWDMVNTVSFKKKPHTNGDAPSH
RNGKSKWSFLFSLTDLKSIKQNKEGMGWSYLVFCLKDDVVLPALHFHQGDSKLLIDSLEK
YVALCESPQDKRTLLVNCQNKSLSQSFENLLDEPAYGLIQKIKKDPYTATMVGFSKVTNY
IFDSLRGSDPSVHQRPPSEMADFLSDAIPGLKINQQEEPGFEVITKIDLGERPVVQRREP
VSLEEWTKNVDSEGRILNVDNMKQMIFRGGLSHALRKQAWKFLLGYFPWDSTKEERTQLQ
KQKTDEYFRMKLQWKSVSEEQEKRNSRLRDYRSLIEKDVNRTDRTNKFYEGQDNPGLILL
HDILMTYCMYDFDLGYVQGMSDLLSPLLYVMENEVDAFWCFASYMDQMHQNFEEQMQGMK
TQLIQLSTLLRLLDSGFCSYLESQDSGYLYFCFRWLLIRFKREFSFLDILRLWEVMWTEL
PCKNFHLLLCCAILESEKQQIMEKHYGFNEILKHINELSMKIDVEDVLCKAEAISLQMVK
CKELPQAVCEILGLQDSEVTTPDSDNGEDENTGMTICPASAFQSNLLPVLTASGGRDDNP
TEISMSPNVSRLTPA
Download sequence
Identical sequences F1N090
ENSBTAP00000030401 ENSBTAP00000030401 9913.ENSBTAP00000030401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]