SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N0T6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N0T6
Domain Number 1 Region: 57-394
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.94e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000181
Further Details:      
 
Domain Number 2 Region: 408-503
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 5.73e-20
Family Anticodon-binding domain of Class II aaRS 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1N0T6
Sequence length 506
Comment (tr|F1N0T6|F1N0T6_BOVIN) Probable histidine--tRNA ligase, mitochondrial {ECO:0000313|Ensembl:ENSBTAP00000035214} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=HARS2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MPQLGLLPGRAWTVLLGLLRPPPGALCIRAVRSHSQVAEALIASQLKPHQEKSNFTIKTP
KGTRDLSPQQMVVREKILDVVVSCFKRHGAKGLDTPAFELKEILTEKYGEDSGLIYDLKD
QGGELLSLRYDLTVPFARYLAMNKVKKMKRYHVGKVWRRESPTIVQGRYREFYQCDFDIA
GQFDPMIPDAECLKIMCEILSGLHLGDFLIKVSDRRILDGIFAVCGVPESKFHAICSSVD
KLDKISWKDVRHEMVVKKGLAPEVADRIGDYVQCHGGISLVEQMFQDPRLSQNKQALEGL
GDLKLLFEYLTLFGVAEKVSFDLSLARGLDYYTGVIYEAVLLQTPVHAEEEPLNMGSVAA
GGRYDGLVGMFDPRGHKVPCVGLSIGVERIFSIVEQRIKTFGEKIRTTETQVFVATPQKN
FLQERLKLIAELWDAGIKAELMYKNNPKLLPQLHYCENMGIPLVVIIGEQELKEGVIKLR
SVASREEVAIKRENLVAEIQKRLSES
Download sequence
Identical sequences F1N0T6
XP_010805666.1.76553 XP_019820624.1.53367 ENSBTAP00000035214 9913.ENSBTAP00000035214 ENSBTAP00000035214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]