SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N2T5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N2T5
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily SNARE-like 3.66e-34
Family Synatpobrevin N-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1N2T5
Sequence length 306
Comment (tr|F1N2T5|F1N2T5_BOVIN) SEC22 homolog A, vesicle trafficking protein {ECO:0000313|Ensembl:ENSBTAP00000019691} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SEC22A OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSMILSASVIRVRDGLPLSASTDYEQGTGMQECRKYFKMLSRKLAQLPDRCTLKTGRYNI
NFISSMGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQ
RTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQISMGELGSANGVTSAFSVDYKGAGKISS
AHQRLEPATLSGIVAFILSLLCAALNLIRGFHAIESLLQSSGYDLFYLVLSFLKTHTIHF
QIYLLIWIKSWPSVKSFLTFGLICLCMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQGK
APDYDV
Download sequence
Identical sequences F1N2T5
ENSBTAP00000019691 ENSBTAP00000019691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]