SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N339 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N339
Domain Number 1 Region: 224-526
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.89e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000296
Further Details:      
 
Domain Number 2 Region: 115-220
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-31
Family SH2 domain 0.000000753
Further Details:      
 
Domain Number 3 Region: 10-109
Classification Level Classification E-value
Superfamily SH2 domain 1.1e-28
Family SH2 domain 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1N339
Sequence length 597
Comment (tr|F1N339|F1N339_BOVIN) Tyrosine-protein phosphatase non-receptor type {ECO:0000256|PIRNR:PIRNR000929} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PTPN11 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MLLFCLKTLWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKI
QNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGH
LSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDAKSKVTHVMIRCQE
LKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKL
AETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGD
PNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMT
TKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLTDQASGDQSPLPPCTPTPSCAEMREDNARVYENVGLMQQQKSFR
Download sequence
Identical sequences F1N339
ENSBTAP00000002653 ENSBTAP00000002653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]