SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N376 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N376
Domain Number 1 Region: 246-514
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-95
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000384
Further Details:      
 
Domain Number 2 Region: 109-221
Classification Level Classification E-value
Superfamily SH2 domain 2.88e-30
Family SH2 domain 0.0000141
Further Details:      
 
Domain Number 3 Region: 4-107
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-27
Family SH2 domain 0.00000773
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1N376
Sequence length 514
Comment (tr|F1N376|F1N376_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000033929} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LOC526769 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
PLHFRWFHPNISGVEAEQLLMSSGQHGSFLARPSKSCPGGFTLSVRRHNEVTHIKIQNTG
DYYDLYGGEKFATLAELVQHYTGQHGGLLRERGGAPVELRHPLGCQDPTSERWYHGHLSG
KEAEKLLMEKGRPGSFLVRESQSKPGDFVLSVLTQQLDRVDRQPRVTHIMIHFQPDGKYD
VGGGEQFDTLGDLVERYRKNPMVERSGVVVHLRQPLKATRISAASIESRVQELSEATDAS
EKAKQGFWEEFEMLQQQECRLLYPRKEGQRPENKPKNRYKNILPFDTTRVILHDVDDRVP
GADYINANYIRSDPEEKPGHGLGKVYIATQGCLPTTVAAFWAMVHQENTHVIVMTTREVE
RGRNKCFRYWPELHGSQEYGHLHVCNMAEHWAQGYCVRELQVWRPDQEESPHTVKHYQYF
SWPDHGVPAEPTGVLSFLEEVNRTHSSMPGAGPMVVHCSAGIGRTGTIIVIDILVDVIRR
QGLDCDIDVPKTIQLVRRQRSGMVQTEAQYKFVY
Download sequence
Identical sequences F1N376
ENSBTAP00000033929 ENSBTAP00000033929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]