SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N3G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N3G1
Domain Number 1 Region: 123-288
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-37
Family Dual specificity phosphatase-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1N3G1
Sequence length 796
Comment (tr|F1N3G1|F1N3G1_BOVIN) Protein tyrosine phosphatase domain-containing protein 1 {ECO:0000313|Ensembl:ENSBTAP00000007630} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PTPDC1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MQDPPRRLSAVPFLSSFFEGRRHSASDPILRLQQGQRSSAAKVLSSSSLQVMVAMSSVSC
AERNPTCPERKRNSGRPTPKYTKVGERLRHVIPGHVACSMACGGKACKYENAARWSEQEQ
AVKGIYSSWVTDNILAMARPSTEVLEKFCIIEQFRSHGIKSIINLQRPGEHASCGNPLEQ
ESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGR
TGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLIPLRNIFSCCDP
KAHAVTLAQYLIRQRHLLHGYEARLLKHIPKIIHLVCKLLLDLAENRPVVTEVADIPGLS
AEIEKTVSEMITRQLDKELLRHDSDASDSFTPTAVVMDFENQDVVLSSEQELDPLWKRRN
VECLQPLAHLKRQLSYSDSDLKRAESLLEQGRTPWTVPAQALLCHNPRQQKHISRCYSPQ
SPQLDLNKETLVRNTFSFWNHTKFGVPEGLKDDGSSIFHRTSIPKEVQRSRTFSSGISDS
YNPGEPVTPNFANIPKGPNSSQQKVYHCECESHGGCGPSSVAEDGETCRRPVDCGSSPKA
QFLGNETQNSKYLSEVAAHMPLQSELSVEARRILAAKALANLNEIAEKEEVKKKVEMWQK
ELNSRDGAWERICGEKDPFILCSLMWSWVEQLKEPVITKEDMDMLVDRCADASEALFLLE
KGQQQTILCVLHCIVSLQTIPADVEEAVLARAIKAFTKVNFDSENGPIVYNTLKKIFKRT
LEEKRKMTKDNPEPGI
Download sequence
Identical sequences F1N3G1
ENSBTAP00000007630 ENSBTAP00000007630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]