SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N420 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N420
Domain Number 1 Region: 35-139
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.01e-41
Family Nucleoplasmin-like core domain 0.0000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1N420
Sequence length 176
Comment (tr|F1N420|F1N420_BOVIN) Nucleophosmin/nucleoplasmin 3 {ECO:0000313|Ensembl:ENSBTAP00000021730} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=NPM3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAAGAAAALTFLDQESRVRAGGVGSLQVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDA
EHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPV
TFRLKSGSGPVRITGRHQIVTISNDLSEEESEEDGSEEEEAELCPVLPAKKLGRRL
Download sequence
Identical sequences F1N420 L8J182
9913.ENSBTAP00000021730 ENSBTAP00000021730 NP_001192489.1.59421 NP_001192489.1.76553 XP_005888149.1.15283 XP_019808764.1.53367 ENSBTAP00000021730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]