SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N471 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N471
Domain Number 1 Region: 377-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.11e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.14e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.84e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 488-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.66e-24
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 6 Region: 600-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 7 Region: 7-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 8 Region: 656-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-22
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 9 Region: 702-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000153
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000374
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 11 Region: 228-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000303
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1N471
Sequence length 758
Comment (tr|F1N471|F1N471_BOVIN) Zinc finger protein 41 {ECO:0000313|Ensembl:ENSBTAP00000002726} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZNF41 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
HSKCQDTLVSFEDVTVDFSQEEWQHLDPVQQRLYWDVTLETYSHLCAVGYQVPKPEVIFR
LEQGEGSWTLDKETPHHSCSDEDIGQTQQQRISGEVSFHCEKIGQSIGKDSLCSIIEELW
QGNDQLERNQENRNNPLSHVKVLTKERGYEYKNIEKIIHVSTRLVPSIKRLHNFDTFGKS
LKHTLNLHNHNKSNATKNFDKIFGNGNNFAHSSSFTKNENANIGTNSYELNQCEKHLDHK
QVLAHHQKIHTGEKLYICTEYVNTFTQESHLFEHQRINAGEKSHECNKDENIFTQKPQIE
VPQSVYTREKPFICIQCGKAFTLRSNLITHQKIHTGQKPYKCSECGKAFFHRSYLFRHMR
IHTGEKPYECNECGRGFSQNSDLSIHQKTHTGEKHYACSECGKAFTRKSALRMHQRIHTG
EKPYICTECGKAFIQKSHFNTHQRIHTGEKPYECSDCGKSFIKKSQLHVHQRIHTGEKPY
ICTECGKVFTHRTNLTTHQKTHTGEKPYMCAECGKAFSDQSNLIKHQKTHTGEKPYKCNG
CGKAFIWKSRLKIHQKSHIGERHYECNECGKAFIQKSTLSVHQRIHTGEKPYACPECGKA
FIQKSHFIAHHRIHTGEKPYACSDCGKCFTKKSQLRVHQKIHTGEKPNICAECGKAFTDR
SNLITHQKIHTREKPYKCSDCGKTFTWKSRLSIHQKSHTGERHYECSKCGKAFIQKATLS
MHQIIHTRKKAYACTQCQKAFTDRSNLIKHQKTHSAEK
Download sequence
Identical sequences F1N471
9913.ENSBTAP00000002726 ENSBTAP00000002726 ENSBTAP00000002726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]