SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N4K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N4K4
Domain Number 1 Region: 68-286
Classification Level Classification E-value
Superfamily DNA-glycosylase 4.4e-64
Family Mismatch glycosylase 0.000037
Further Details:      
 
Domain Number 2 Region: 333-474
Classification Level Classification E-value
Superfamily Nudix 1.98e-26
Family MutY C-terminal domain-like 0.00000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1N4K4
Sequence length 526
Comment (tr|F1N4K4|F1N4K4_BOVIN) MutY DNA glycosylase {ECO:0000313|Ensembl:ENSBTAP00000014928} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=MUTYH OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MKKSRAAVGNRSGRRKQASSQEGKEKCAFGSSQAKPSAPSAGPARQQKALLQASVSPYHL
FRDVAEVTALQESLLDWYDRKKRDLPWRRLVEDEVDLDRRAYAVCFTDVMLQQTQVATVI
NYYTRWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGRWLQEGARKVVEELGGHMPRTAE
TLQQFLPGVGRYTAGAIASIAFGQAAGVVDGNVIRVLCRVRAIGADSSSTLVSQHLWSLA
QQLVDPARPGDFNQAAMELGAIVCTPKRPLCSHCPVQNLCRARQRVEREQLSASQSLPGN
CDVEECAPNTGQCPLCAPPTEPWDQTLGVTNFPRKASRKPPREECSAICVLEQPKALGGA
HILLVQRPNSGLLAGLWEFPSVSVNAEASGQHQRAALLQELQSWVGPLPDTRLQHLGQVV
HTFSHIKMTYQVYSLALEEHTPVTIVPPGARWLTREDFHTAAVSTAMKKVFRMYEGQQPG
TCKGSKRSQVATLSKRKKPSPGQQVLESFFWPHVPTDAPSLNTAAQ
Download sequence
Identical sequences F1N4K4
ENSBTAP00000014928 ENSBTAP00000014928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]