SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1N5D4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N5D4
Domain Number 1 Region: 18-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.32e-40
Family Ephrin receptor ligand binding domain 0.0000252
Further Details:      
 
Domain Number 2 Region: 404-532
Classification Level Classification E-value
Superfamily Fibronectin type III 2.22e-25
Family Fibronectin type III 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1N5D4
Sequence length 604
Comment (tr|F1N5D4|F1N5D4_BOVIN) Ephrin type-B receptor 6 precursor {ECO:0000313|Ensembl:ENSBTAP00000033341} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=EPHB6 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MVGSLWVLALVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEAC
HVAGAAPGLGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVAGGTCRETFTLYYRQA
EEPDGPDSISSWHLKRWTKVDTIAADESFPASSAWAVGPPRAGQRAGLQLNVKERRALNP
ARLLRGFPGHGGLPGVAVKLFSYACPSVLRAFASFPETQASGAGPPWWRPWAPVWHTRSR
RRMEQGARQRAAPPGCTATGRASGWLPSGAAAASQGTSLRGETRPAKPALGGPTKPWLGM
PPAHHALPAATPWPLPCVPLPGGLLPGQFRPPRGSLHWPTVSPPGAVVRGAGLRPHAALA
PASGAWGPRGPAFQRGVQGVRRGRQGPCRRCRDEVHFDPRQRGLTESRVLIGGLRPHVPY
ILEVQAVNGVSELSPDPPQAAAINVSTSHAVPSAVPAVHQVSRASNSITVSWPQPDQTNG
NILDYQLRYYDQAEDESHSFTLTSETNTATVTKLSPGHIYGFQVRARTAAGHPMGARSTS
RRCLKVSCPLNFLRGFPWWLGPSWGRWPSFCWRPSPCWLSSSRGSGVEPATWNNCSSTAA
QVGV
Download sequence
Identical sequences F1N5D4
ENSBTAP00000033341 ENSBTAP00000033341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]