SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N5T8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N5T8
Domain Number 1 Region: 408-526
Classification Level Classification E-value
Superfamily EF-hand 4.64e-16
Family Calmodulin-like 0.019
Further Details:      
 
Domain Number 2 Region: 142-234
Classification Level Classification E-value
Superfamily EF-hand 0.00000273
Family Calmodulin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1N5T8
Sequence length 531
Comment (tr|F1N5T8|F1N5T8_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000002128} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
METKGHLFCQGEENTDSSDDDCNSVAADLLSRDIDSKKYIKFSKTTEKRISPEIRGLSPE
HTKKYETSIFLLGEEKSSSFSGEKKGRRKKSLQVQLHTKRTEVKPVFLIIMKEKMTRKES
SLCKLPSQCSIHKTLSPLDRSSSVIRYDVFINRLWDLRFFDCLKIFLYILYFAAFQNALK
IFHRIKCGRVPVSEVDKVLDSMDILVVPETLQEVIKYADINSNQMVDIGDIIFTLDELQQ
EYENISIMEGTALDEATSRKLSNVSGCYPQYRKKSILSSGLSESSLFQKSNTKSLQNHKI
MSENDDYEFKRPKNILQIRKFQDEIDSSDIEFQEPYSKDGMNFKKSSEKVEIHDSKSKPQ
DLKHVSGLKKSLDKSDIFSIPKLQKPAVRRSSSLLKQVSSKEKTAINALGNVCETIKKLQ
ENYIDAEELQSILPSIGITLSDKEFKKIVTDTARNENGMVKLDDFVSAVSKEQNLPEYDV
LTDVVKAIDKIKDENIDYGDLNTCLQNLGVYLSKPEFQKITELTEVGGKKK
Download sequence
Identical sequences F1N5T8
ENSBTAP00000002128 ENSBTAP00000002128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]