SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N6N3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N6N3
Domain Number 1 Region: 276-364
Classification Level Classification E-value
Superfamily EF-hand 1.26e-22
Family Eps15 homology domain (EH domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 3-119
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000071
Family G proteins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1N6N3
Sequence length 367
Comment (tr|F1N6N3|F1N6N3_BOVIN) EH domain-containing protein 1 {ECO:0000313|Ensembl:ENSBTAP00000002174} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=EHD1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
GYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQ
QLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPR
NAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQ
ISPGDFPNLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPAQ
VVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANA
KKEMVKSKLPNTVLGKIWKLADVDRDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVP
PSKRRHE
Download sequence
Identical sequences F1N6N3
ENSBTAP00000002174 ENSBTAP00000002174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]