SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N6Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N6Q3
Domain Number 1 Region: 383-549
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.9e-19
Family G proteins 0.016
Further Details:      
 
Domain Number 2 Region: 17-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.21e-19
Family G proteins 0.0032
Further Details:      
 
Domain Number 3 Region: 137-237,279-336
Classification Level Classification E-value
Superfamily EF-hand 1.08e-18
Family Calmodulin-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1N6Q3
Sequence length 587
Comment (tr|F1N6Q3|F1N6Q3_BOVIN) Mitochondrial Rho GTPase {ECO:0000256|PIRNR:PIRNR037488} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=RHOT2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
QVPARAEEITIPADVTPEKVPTHIVDYSETEQTVEELQGEIDKADVVCVVYDVSEEATVE
KIRTKWIPLVNGDTKRGPRVPIILVGNKSDLRPGGSMEAVLPIMSQFPEIETCVECSAKN
LKNISELFYYAQKAVLHPTAPLYDPEAKQLRPACAQALTRIFRLSDQDMDQALSDQELNA
FQTSCFGHPLAPQALEDVKMVVSKNVVGGVRDDQLTLDGFLFLNTLFIQRGRHETTWTIL
RRFGYGDSLELTADYLCPPLRVPPGCSAELNHRGYQFVQRMFEKHDQDRDGALSPAELQS
LFSVFPAAPWGPHLPSTVRTKAGRLPLHGYLCQWTLVTYLDVRRSLEHLGYLGYPTLCEQ
DSQAHAITVTREKRLDQEKGQTQRNVLLCKVVGARGVGKSSFLRAFLGHSLGHQDAGEPS
VYAIDTVQVNGQEKYLILCEVAADSLLTASADASCDVACLMFDGSDLRSFALCASVYKQH
YMDGQTPCLFVCSKADLPGGVPLPGLSPAEFCRRHRLPTPTLFSCAGPVEPCMGIFTRLA
TMATFPHLVHGQLQATSFWLRVALGAMGAAVAAILSFSLYRVLVKSR
Download sequence
Identical sequences F1N6Q3
ENSBTAP00000005979 ENSBTAP00000005979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]