SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1N7N9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N7N9
Domain Number 1 Region: 22-144,176-283
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.74e-77
Family Calponin-homology domain, CH-domain 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1N7N9
Sequence length 527
Comment (tr|F1N7N9|F1N7N9_BOVIN) Spectrin repeat containing nuclear envelope protein 2 {ECO:0000313|Ensembl:ENSBTAP00000012582} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SYNE2 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MASSPVLPAEDQQVSLGIDDLHFSLQAEQEDTQKKTFTCWINSQLAKHTPPSVVTDLFTD
IKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRINIENALTFLQNQSIKLINIHVTDIIDGN
PSIVLGLIWTIILHFHIEELARTLPGNYSQPSLDSVSAVDSSPTSSPPAKKCSKVQERWR
MSAKKALLQWAQEQCASYESVNVTDFKSSWRNGMAFLAVIHALRPDLIDMKSVKHRSNRD
NLKEAFRIAEQELKIPKMLEPEDVDVVNPDEKSIMTYVAQFLQYSKKAPGSGDEAQGKVK
DAMVWLALQEKKVHKMLTDSENETYCKTYESLLSFLESFNKEKERFLDVLTIKRNVDDLN
KDQLQLREAWDGLNYQINVWQTELNRVLPSPLYQIETWLQEVEKLIDEDLSVSQDYSEAM
ALTQEKITLFQSLMDKFDCHLNTLLAFENRDENHLPLVPPEKLEEMKRRINNISGKKVIP
RLEFHYYECSVLGLLEEVKSKLLVWNIKYGSKESVELLLEDWHEKFL
Download sequence
Identical sequences F1N7N9
ENSBTAP00000012582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]