SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1NEB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1NEB3
Domain Number 1 Region: 295-553
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.28e-79
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 182-286
Classification Level Classification E-value
Superfamily Kringle-like 7.01e-30
Family Kringle modules 0.00043
Further Details:      
 
Domain Number 3 Region: 83-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000121
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  F1NEB3
Domain Number - Region: 121-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00178
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1NEB3
Sequence length 560
Comment (tr|F1NEB3|F1NEB3_CHICK) Hyaluronan binding protein 2 {ECO:0000313|Ensembl:ENSGALP00000032462} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=HABP2 OC=Phasianidae; Phasianinae; Gallus.
Sequence
MRSVNGALSLRVLSLILFLGNTYVSPSWSSLANLVNDEADDYEYEYYDEYVQVEEKLSQE
ILLLGEPDWVDPSPLYRRIQQEDLCSSNPCKNNGWCEMRGSNFTCLCPRPYTGDTCGEVE
DTCVDHNCVRGDCLVTLTKPYYQCSCSHPYKLPDCQQASSQCRPNPCKNGGICVRHRIRS
KFTCKCPERYRGRFCEIEPDDCYEEDSFYYRGRVNQAQSGRTCLHWNSHLLLRFSINAFM
EDAESYGIGEHNFCRNPDEDQKPWCFIRNNGKVQWDFCDVSPCSGTDEERQEQEDEMFKT
CGQPESQRGLRRIYGGTKTTAGKHPWMVSLQRKSSRRVTHFCGGALIKSCWVLTAAHCVE
HGAENLQVALGKQNLKRREHQEQIFDVEKVIMHHRYRLGDDDVPYNDIALLKLKPIDGQC
AIETKYVKTACLPDFEFPVGTDCFISGWGETETGDMSLQLLDTSVKLISQKQCNAPRVYD
QRLDESMFCAGNLRRGRTDSCQGDSGGPLTCVENGLYYVYGIVSWGDQCGLKNKPGVYTQ
VTSFLRWIKYKIQTESLSDQ
Download sequence
Identical sequences F1NEB3
ENSGALP00000032462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]