SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1NM67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1NM67
Domain Number 1 Region: 125-368
Classification Level Classification E-value
Superfamily vWA-like 5.19e-85
Family Integrin A (or I) domain 0.000000361
Further Details:      
 
Domain Number 2 Region: 378-454
Classification Level Classification E-value
Superfamily Integrin domains 2.56e-20
Family Integrin domains 0.00085
Further Details:      
 
Domain Number 3 Region: 623-701
Classification Level Classification E-value
Superfamily Integrin beta tail domain 8.89e-18
Family Integrin beta tail domain 0.004
Further Details:      
 
Domain Number 4 Region: 26-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000335
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 537-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000046
Family Integrin beta EGF-like domains 0.0024
Further Details:      
 
Weak hits

Sequence:  F1NM67
Domain Number - Region: 581-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Domain Number - Region: 459-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0218
Family Integrin beta EGF-like domains 0.03
Further Details:      
 
Domain Number - Region: 502-529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0289
Family Integrin beta EGF-like domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1NM67
Sequence length 773
Comment (tr|F1NM67|F1NM67_CHICK) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=ITGB2 OC=Phasianidae; Phasianinae; Gallus.
Sequence
MPRDCCLWLPAMTWVLLLLTTAFAAECPKIKVGTCKNCIQSGPGCAWCKKLSFTKAGEPD
SNRCDTIEQLQQRGCPENEIEFPVNEIKRTQDSAFSNKIQLTPQEVHLKLRIREPAEFDV
KFRRATGYPIDIYYLMDLSYSMLDDLENVKKLGGQLLRALESTTPSRRIGFGSFVDKTVL
PFVNTHPEKLKNPCPNKDSNCQPPFAFKHILSLTDNAEKFESEVGKQFISGNLDAPEGGL
DAMMQAAVCGDLIGWRNVTRLLVYATDDGFHFAGDGKLGGILTPNDGQCHLEDNMYKKSN
EFDYPSVGQLVQKLAENNIQPIFAVTSKMVDVYKKLSDMIPKSAVGELNEDSSNIIELIQ
VAYNNLSSRIILDHSTLPDVLDVKYDSICNNNTGAKNEARGQCDNVKINDEVTFKVKVTA
NECIKSQSFTIRPLGFTDTLTVHLDSICDCDCREQPDPTACSGNGKVVCGICSCNLSYTG
KNCECDTKGKTSKELEGSCRKDNSSVICSGLGDCVCGQCVCHTSDVPGKEIYGTFCDCDN
MNCEFHNGSLCGGEERGRCDCGECKCTPKYEGSACQCKKSTDGCRNSRQNECSLRGSCHC
NRCQCRGGYQPPFCEECPGCPSPCGRHISCVECKSFNSGPLAKNCSVACTSIQLADEPRA
GSRQCKEKDSENCWISFYMAQDDGEEMYTVTVDPKKECPEPPNIALIVGSTIAGVALIGL
LLLLTWRLLTEIFDRREYRRFEKEKSKAKWNEADNPLFKSATTTVMNPRFDGQ
Download sequence
Identical sequences F1NM67
9031.ENSGALP00000012130 ENSGALP00000012130 ENSGALP00000012130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]