SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1NPH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F1NPH4
Domain Number - Region: 39-160
Classification Level Classification E-value
Superfamily E set domains 0.000532
Family Arrestin/Vps26-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1NPH4
Sequence length 336
Comment (tr|F1NPH4|F1NPH4_CHICK) VPS26, retromer complex component B {ECO:0000313|Ensembl:ENSGALP00000002310} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=VPS26B OC=Phasianidae; Phasianinae; Gallus.
Sequence
MSFFGFGQSAEVELVLSDAESRRRVEHKTEEGKKEKYFLFYDGETVSGRVILTLKHPNRR
LEHQGIKVEFIGQIELYYDRGNHHEFVSLVKDLARPGEFTQSQIFDFEFTHVEKPYESYT
GQNVKLRYFLRATVSRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNK
SKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVR
GESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR
KSMSHQAAIASQRFEGTSSHTEAKTPSQPAENNGRQ
Download sequence
Identical sequences F1NPH4 G1MS48
XP_003212753.1.16129 XP_021231648.1.32913 XP_417878.1.86415 ENSMGAP00000001087 ENSMGAP00000001087 ENSGALP00000002310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]