SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1NY48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1NY48
Domain Number 1 Region: 106-390
Classification Level Classification E-value
Superfamily L domain-like 1.79e-49
Family Ngr ectodomain-like 0.0065
Further Details:      
 
Domain Number 2 Region: 246-259,412-713
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.39e-45
Family Rhodopsin-like 0.00069
Further Details:      
 
Domain Number 3 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1NY48
Sequence length 763
Comment (tr|F1NY48|F1NY48_CHICK) Relaxin/insulin like family peptide receptor 1 {ECO:0000313|Ensembl:ENSGALP00000015337} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=RXFP1 OC=Phasianidae; Phasianinae; Gallus.
Sequence
MTSDWCFYIFLLIGTKVIRDSLEDPVSRGGAACPLGYFPCGNITKCLPQQLHCNGEDDCG
NHADEDNCEDNNGWSLQFDKHYTLDKMKSLYAFQTKTPECLAGAVPVECKCQGLEVFCDA
AKLRDVPLVPSNITTMSLQKNLLRKLYADVFRKYQDLKNLYLQDNKIRAVSKHAFKGLYN
LTKLYLSNNKITNLKPRVFEDLHKLEWLIIENNRINRISPSTFYGLKSLILLDMMNNSLA
HLPDKPLCQYMPRLNWLDLEGNHIHHLRNVTFISCSTLTVLVMRQNKISSLNENSFSSLQ
MLDELDLASNEIESLPAYVFKDLKELSQLNLSYNPIKKIQIDQFDFLTKLKSLSLEGIEI
ANIQRRMFIPLRNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVV
SAITCFGNIFVICMRPYIRSENKLHAISIMSLCCADCLMGIYLFVIGAFDLKYRGEYNKH
AQLWMDSIHCQLVGSLAILSTEVSVLLLTYLTLEKYICIVYPFRCLKPRKCRTISILVLI
WVIGFAVAFIPLSNKEFFRNYYGTNGVCFPLHSEQSESSGSQIYSVVIFLGVNLAAFLII
VFSYGSMFYSVHQTAIMATEIQNHIKKEMILAKRFFFIVFTDALCWIPIFILKLLSLLQV
EIPGTITSWVVIFILPINSALNPLLYTLTTRPFKEMIHQFWYNYRQRRSKRGKGSQKAYG
PSFIWVEMWPMHEITPKLTKPVLCTDSSDASVTTQSTRLNSYT
Download sequence
Identical sequences F1NY48
XP_420385.2.86415 ENSGALP00000015337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]