SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1P1W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1P1W9
Domain Number 1 Region: 166-238
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.18e-29
Family POU-specific domain 0.0000311
Further Details:      
 
Domain Number 2 Region: 243-320
Classification Level Classification E-value
Superfamily Homeodomain-like 1.67e-18
Family Homeodomain 0.00022
Further Details:      
 
Weak hits

Sequence:  F1P1W9
Domain Number - Region: 82-145
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0785
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1P1W9
Sequence length 416
Comment (tr|F1P1W9|F1P1W9_CHICK) POU domain protein {ECO:0000256|RuleBase:RU361194} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN= OC=Phasianidae; Phasianinae; Gallus.
Sequence
MSSDAADSTDTRHEPDQVEPGSEQNGLDFNRQIKTEDLSDSLQSTIPPRSGHLVQGSSMM
PGSQIAGDMSSLHTLQQLVLLPGHMQSVPQFLLSQSQAGQQALQPNILSFPQQQGSLLLS
QPGPSLASQAVGRSGLPGSSVEPHLDVPQHLQVAKHLTPSGASEEPSDLEELEKFAKTFK
QRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLSDAESA
PLDSSMSTPSSYPSVNEMFGRKRKKRTSIETNIRSTLEKRFQDNPKPSSEEISLIAEQLS
MEKEVVRVWFCNRRQKEKRISCPMPSPIKSPIYNSRLVSTSGSLGPLSVNPVHSTMPGTV
TSSCSPGNSSRPSSPGSALHASSPSTAQSNSKAAMNSSGFNSSGSWYRWNQPTYLH
Download sequence
Identical sequences F1P1W9
ENSGALP00000010779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]