SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1P6G0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1P6G0
Domain Number 1 Region: 51-520
Classification Level Classification E-value
Superfamily Sema domain 7.06e-130
Family Sema domain 0.0000184
Further Details:      
 
Domain Number 2 Region: 1360-1486,1681-1870
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-53
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 962-1050
Classification Level Classification E-value
Superfamily E set domains 9.04e-16
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 4 Region: 1049-1153
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000102
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.072
Further Details:      
 
Domain Number 5 Region: 865-963
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000743
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 523-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000157
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1150-1240
Classification Level Classification E-value
Superfamily E set domains 0.000000504
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 
Domain Number 8 Region: 818-850
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000353
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1P6G0
Sequence length 1900
Comment (tr|F1P6G0|F1P6G0_CANLF) Plexin A1 {ECO:0000313|Ensembl:ENSCAFP00000005952} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PLXNA1 OC=Canis.
Sequence
MPLPRLSLRVLLPPLPPLLLLPLLLLLLLRGAQGAAGAPRADGGQQPTFRTFLASDWGLT
HLVVHEQTGEVYVGAVNRIYKLSGNLTLLRAHVTGPVEDNEKCYPPPSVQSCPHGLGSTD
NVNKLLLLDYAANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVREAGSMAGV
LIAGPLGQGQAKLFVGTPIDGKSEYFPTLSSRRLMANEEDADMFGFVYQDEFVSSQLKIP
SDTLSKFPAFDIYYVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTSKIVRLCVDDPKF
YSYVEFPIGCEQAGVEYRLVQDAYLSRPGRALARQLGLAEDEDVLFTVFAQGQKNRVKPP
KESVLCLFTLRAIKEKIKERIQSCYRGEGKLSLPWLLNKELGCINSPLQIDDDFCGQDFN
QPLGGTVTIEGTPLFVDKDDGLTAVAAYDYRGRTVVFAGTRSGRIRKILVDLANPGGRPA
LAYESVVAQENSPILRDLVLSPDRQYLYAMTEKQVTRVPVESCVQYTSCELCLGSRDPHC
GWCVLHSICSRQDACERADEPQRFASDLLQCVQLMVQPRNVSVTMSQVPAWNVPDLSAGV
NCSFEDFTESESILEDGRIHCRSPSAREVAPITRGQGDQRVVKLYLKSKETGKKFASVDF
VFYNCSVHQSCLSCVNGSFPCHWCKYRHVCTHNAADCAFLEGRVNVSEDCPQILPSTQIY
VPVGVVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYSYEG
NDVSDLPVNLSVVWNGNFVIDNPQNIQAHLYKCPALRESCGLCLKADPRFECGWCVAERR
CSLRPHCPGDSPAAWMHARHGSSRCTDPKILKLFPETGPRQGGTRLTITGENLGLRFEDV
RLGVRVGKVLCSPVENEYISAEQIVCEIGDASTVRAHDALVEVCVRDCSPHYRALSPKRF
TFVTPTFYRVSPARGPLSGGTWIGIEGSHLNAGSDVAVSVGGRPCSFSWRNSREIRCLTP
PGQSPGSAPIVININRAQLTNPEVKYNYTEDPTILKIDPEWSINSGGTLLTVTGTNLATI
REPRIRAKYGGVERENSCLVYNDTTMVCRAPSVDNPSRSPPELGERPDELGFVMDDVRAL
LVLNASSFVYYPDPVLEPLSPTGLLELKPSSPLILKGRNLLPPAPGNSRLNYTVLIGSTP
CALTVSETQLLCESPNLTGQHKVTVRAGGFEFSPGMLQVYSDSLLTLPAIVGIGGGGGLL
LLVIVAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDG
AGIPFLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLE
AQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESV
AEKMLTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQ
QIDYKTLTLNCVNPENENAPEVPVKGLNCDTVTQVKEKLLDAVYKGVPYSQRPKAGDMDL
EWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTF
TKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVS
EIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADQHQIHDSDV
RHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHKLGKDSP
SNKLLYAKDIPNYKSWVERYYADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIY
SYITKYKDEILTALEKDEQARRQRLRSKLEQVVDTMALSS
Download sequence
Identical sequences F1P6G0
ENSCAFP00000005952 ENSCAFP00000005952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]